XRCC3 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human XRCC3. Source: E. coli Amino Acid Sequence: TQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
XRCC3 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56545. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for XRCC3 Recombinant Protein Antigen
Background
XRCC3, also known as DNA repair protein XRCC3, X-ray repair cross-complementing protein 3, and CMM6, belongs to the RecA family and the RAD51 subfamily. XRCC3 plays a role in the homologous recombination repair (HRR) pathway of double-stranded DNA. The pathway is responsible for repairing chromosomal fragmentation, translocations, and deletions. Additionally, XRCC3 is also involved in regulating the mitochondrial DNA copy number in the presence of oxidative stress in the presence of RAD51 and RAD51C. XRCC3 is a functional compliment to Chinese hamster irs1SF. Rare microsatellite polymorphisms in the XRCC3 gene have been associated with cancer in patients with radiosensitivity. Defects of the XRCC3 gene have also been linked to breast cancer and cutaneous malignant melanoma type 6 (CMM6).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
Species: Hu, Mu, Pm, Ye
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu(-)
Applications: ICC/IF, WB
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
Species: Hu, Mu(-), Pm
Applications: ICC/IF, WB
Species: Hu, Mu, Po, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
Species: Hu
Applications: IHC, WB
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Publications for XRCC3 Recombinant Protein Antigen (NBP2-56545PEP) (0)
There are no publications for XRCC3 Recombinant Protein Antigen (NBP2-56545PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for XRCC3 Recombinant Protein Antigen (NBP2-56545PEP) (0)
There are no reviews for XRCC3 Recombinant Protein Antigen (NBP2-56545PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for XRCC3 Recombinant Protein Antigen (NBP2-56545PEP) (0)
Additional XRCC3 Products
Research Areas for XRCC3 Recombinant Protein Antigen (NBP2-56545PEP)
Find related products by research area.
|
Blogs on XRCC3