XRCC2 Antibody [DyLight 680] Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human XRCC2 (NP_005422.1).
Sequence: MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
XRCC2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.
Alternate Names for XRCC2 Antibody [DyLight 680]
Background
RAD51 is a eukaryotic homologue of E. coli RecA, a recombinase, and a component of the homologous recombination DNA repair pathway. RAD51 forms a nucleoprotein filament (through binding RAD52 and single stranded DNA that are exposed following double strand breaks) that initiates recombination. There are five human homologues of RAD51; XRCC2, XRCC3, RAD51B, RAD51C, RAD51D, and they interact among themselves to form one big complex or several smaller complexes. XRCC2 (X Ray Repair Cross Complementing 2), a component of the homologous recombination pathway, is essential for repairing the double strand DNA breaks by homologous recombination between sister chromatids.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Dr, Ha, Hu
Applications: ICC/IF (-), IP, WB
Species: Hu, Mu(-)
Applications: ICC/IF, WB
Species: Hu, Mu, Pm, Ye
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu(-), Pm
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, KD
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Publications for XRCC2 Antibody (NBP3-35804FR) (0)
There are no publications for XRCC2 Antibody (NBP3-35804FR).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for XRCC2 Antibody (NBP3-35804FR) (0)
There are no reviews for XRCC2 Antibody (NBP3-35804FR).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for XRCC2 Antibody (NBP3-35804FR) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional XRCC2 Products
Research Areas for XRCC2 Antibody (NBP3-35804FR)
Find related products by research area.
|
Blogs on XRCC2