XRCC2 Antibody [CoraFluor™ 1]

Product Discontinued

XRCC2 Antibody [CoraFluor™ 1] Summary

• Description: CoraFluor(TM) 1 is a high performance terbium-based TR-FRET (Time-Resolved Fluorescence Resonance Energy Transfer) or TRF (Time-Resolved Fluorescence) donor for high throughput assay development. CoraFluor(TM) 1 absorbs UV light at approximately 340 nm, and emits at approximately 490 nm, 545 nm, 585 nm and 620 nm. It is compatible with common acceptor dyes that absorb at the emission wavelengths of CoraFluor(TM) 1. CoraFluor(TM) 1 can be used for the development of robust and scalable TR-FRET binding assays such as target engagement, ternary complex, protein-protein interaction and protein quantification assays.
  
  CoraFluor(TM) 1, amine reactive
  
  CoraFluor(TM) 1, thiol reactive
  
  For more information, please see our CoraFluor(TM) TR-FRET technology flyer.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human XRCC2 (NP_005422.1).
  
  Sequence:
  MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: XRCC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark. Do not freeze.
• Buffer: PBS
• Preservative: No Preservative
• Purity: Affinity purified

Notes

CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254

Alternate Names for XRCC2 Antibody [CoraFluor™ 1]

• DKFZp781P0919
• DNA repair protein XRCC2
• X-ray repair complementing defective repair in Chinese hamster cells 2
• X-ray repair cross-complementing protein 2
• X-ray repair, complementing defective, repair in Chinese hamster

Background

RAD51 is a eukaryotic homologue of E. coli RecA, a recombinase, and a component of the homologous recombination DNA repair pathway. RAD51 forms a nucleoprotein filament (through binding RAD52 and single stranded DNA that are exposed following double strand breaks) that initiates recombination. There are five human homologues of RAD51; XRCC2, XRCC3, RAD51B, RAD51C, RAD51D, and they interact among themselves to form one big complex or several smaller complexes. XRCC2 (X Ray Repair Cross Complementing 2), a component of the homologous recombination pathway, is essential for repairing the double strand DNA breaks by homologous recombination between sister chromatids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: XRCC2