XRCC1 Recombinant Protein Antigen

Images

 
There are currently no images for XRCC1 Protein (NBP1-87154PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

XRCC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human XRCC1.

Source: E. coli

Amino Acid Sequence: WDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
XRCC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87154.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for XRCC1 Recombinant Protein Antigen

  • DNA repair protein XRCC1
  • RCC
  • X-ray repair complementing defective repair in Chinese hamster cells 1
  • X-ray repair cross-complementing protein 1
  • X-ray-repair, complementing defective, repair in Chinese hamster

Background

XRCC1 (X-ray cross complementing factor-1) is involved in DNA base excision repair. XRCC1 is a 70kDa protein that has been shown to be physically associated with other DNA repair enzymes, including poly (ADP-ribose) polymerase (PARP), DNA Ligase III and DNA polymerase beta. XRCC1 contains a BRCT domain (for BRCA1 carboxyl terminus) which was originally found in the tumor suppressor protein BRCA1. Recently, the BRCT domain has been shown to mediate the protein-protein interaction of XRCC1 and DNA Ligase III-a.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15704
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, PLA, Simple Western, WB
NB100-165
Species: Dr, Ha, Hu
Applications: ICC/IF (-), IP, WB
NB100-106
Species: Hu, Mu, Po, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, WB
202-IL
Species: Hu
Applications: BA
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-45411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB500-704
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-41190
Species: Ch, Hu, Mu
Applications: B/N, ICC/IF, IP, PLA, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32733
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-38600
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-417
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, MiAr, PLA, Simple Western, WB
NBP1-87154PEP
Species: Hu
Applications: AC

Publications for XRCC1 Protein (NBP1-87154PEP) (0)

There are no publications for XRCC1 Protein (NBP1-87154PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XRCC1 Protein (NBP1-87154PEP) (0)

There are no reviews for XRCC1 Protein (NBP1-87154PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for XRCC1 Protein (NBP1-87154PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional XRCC1 Products

Research Areas for XRCC1 Protein (NBP1-87154PEP)

Find related products by research area.

Blogs on XRCC1.

PARP Antibody Assays aid both Apoptosis and Cancer Research
The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our XRCC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol XRCC1