Recombinant Human XRCC1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human XRCC1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 534-633 of Human XRCC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LPVPELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEEALMDNPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
XRCC1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human XRCC1 Protein

  • DNA repair protein XRCC1
  • RCC
  • X-ray repair complementing defective repair in Chinese hamster cells 1
  • X-ray repair cross-complementing protein 1
  • X-ray-repair, complementing defective, repair in Chinese hamster

Background

XRCC1 - X-ray repair complementing defective repair in Chinese hamster cells 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3296
Species: Hu, Mu, Rt
Applications: WB
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB100-165
Species: Hu, Dr
Applications: ICC/IF (-), WB, IP
NB100-106
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-485
Species: Hu
Applications: WB, IP
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-41190
Species: Hu, Mu, Ch
Applications: WB, B/N, ICC/IF, IP, PLA
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-38600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for XRCC1 Partial Recombinant Protein (H00007515-Q01) (0)

There are no publications for XRCC1 Partial Recombinant Protein (H00007515-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XRCC1 Partial Recombinant Protein (H00007515-Q01) (0)

There are no reviews for XRCC1 Partial Recombinant Protein (H00007515-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for XRCC1 Partial Recombinant Protein (H00007515-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional XRCC1 Products

Bioinformatics Tool for XRCC1 Partial Recombinant Protein (H00007515-Q01)

Discover related pathways, diseases and genes to XRCC1 Partial Recombinant Protein (H00007515-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XRCC1 Partial Recombinant Protein (H00007515-Q01)

Discover more about diseases related to XRCC1 Partial Recombinant Protein (H00007515-Q01).
 

Pathways for XRCC1 Partial Recombinant Protein (H00007515-Q01)

View related products by pathway.

PTMs for XRCC1 Partial Recombinant Protein (H00007515-Q01)

Learn more about PTMs related to XRCC1 Partial Recombinant Protein (H00007515-Q01).
 

Research Areas for XRCC1 Partial Recombinant Protein (H00007515-Q01)

Find related products by research area.

Blogs on XRCC1.

PARP Antibody Assays aid both Apoptosis and Cancer Research
The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play...  Read full blog post.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human XRCC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol XRCC1