XPB Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: XPB Antibody [NBP2-58758] - Staining of human cell line A-431 shows localization to nucleoplasm.

ChIP-Exo-Seq composite graph for Anti-ERCC3 (NBP2-58758) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

XPB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit XPB Antibody - BSA Free (NBP2-58758) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEE
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERCC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  XPB Recombinant Protein Antigen (NBP2-58758PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for XPB Antibody - BSA Free

• Basic transcription factor 2 89 kDa subunit
• BTF2 p89
• BTF2
• DNA excision repair protein ERCC-3
• DNA repair protein complementing XP-B cells
• EC 3.6.1
• EC 3.6.4.12
• ERCC3
• excision repair cross-complementing rodent repair deficiency, complementationgroup 3 (xeroderma pigmentosum group B complementing)
• GTF2H
• RAD25
• TFIIH basal transcription factor complex 89 kDa subunit
• TFIIH basal transcription factor complex helicase XPB subunit
• TFIIH p89
• TFIIH
• Xeroderma pigmentosum group B-complementing protein
• xeroderma pigmentosum, complementation group B
• XPB
• XPBC
• XPBTFIIH 89 kDa subunit

Background

ERCC3 is a component of the core TFIIH basal transcription factor and functions as an ATP-dependent 3'-5' DNA helicase. ERCC3 is involved in nucleotide excision repair and is the cause of xeroderma pigmentosum complementation group B (XPB), also known as xeroderma pigmentosum II (XP2). Additionally, it has been found to be the cuase of Cockayne syndrome, and trichothiodystrophy (TTD). XPB is an autosomal recessive disease characterized by skin photosensitivity and a predisposition to skin cancer, and neurological abnormalities. Cockayne syndrome and TTD are similarly characterized by photosensitivity and neural abnormalities.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ERCC3