WWOX Antibody

Western Blot: WWOX Antibody [H00051741-B01P] - Analysis of WWOX expression in 293.

Western Blot: WWOX Antibody [H00051741-B01P] - Analysis of WWOX expression in transfected 293T cell line by WWOX polyclonal antibody. Lane 1: WWOX transfected lysate(20.79 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

WWOX Antibody Summary

• Immunogen: WWOX (NP_570607.1, 1 a.a. - 189 a.a.) full-length human protein. MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWKTKYHPPPEKCRIKIFH
• Specificity: Reacts with WW domain containing oxidoreductase.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: WWOX
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against cell and transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WWOX Antibody

• D16S432E
• EC 1.1.1
• EC 1.1.1.-
• FOR
• FORHHCMA56
• FRA16D
• Fragile site FRA16D oxidoreductase
• SDR41C1
• short chain dehydrogenase/reductase family 41C, member 1
• WOX1
• WOX1PRO0128
• WW domain containing oxidoreductase
• WW domain-containing oxidoreductase
• WW domain-containing protein WWOX
• WWOX

Background

WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 2 WW domains and a short-chain dehydrogenase/reductase domain (SRD). The highest normal expression of this gene is detected in hormonally regulated tissues such as testis, ovary, and prostate. This expression pattern and the presence of an SRD domain suggest a role for this gene in steroid metabolism. The encoded protein is more than 90% identical to the mouse protein, which is an essential mediator of tumor necrosis factor-alpha-induced apoptosis, suggesting a similar, important role in apoptosis for the human protein. In addition, there is evidence that this gene behaves as a suppressor of tumor growth. Alternative splicing of this gene generates transcript variants that encode different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WWOX
• Entrez:
  • 51741(Human)
• Uniprot:
  • NP_570607.1(Human)