WTAP Antibody (1B11) - Azide and BSA Free

Immunohistochemistry-Paraffin: WTAP Antibody (1B11) [H00009589-M01] - Analysis of monoclonal antibody to WTAP on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.

Sandwich ELISA: WTAP Antibody (1B11) [H00009589-M01] - Detection limit for recombinant GST tagged WTAP is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 1B11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

WTAP Antibody (1B11) - Azide and BSA Free Summary

• Immunogen: WTAP (NP_690596.1, 70 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR
• Specificity: WTAP - Wilms tumor 1 associated protein (1B11)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: WTAP
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WTAP Antibody (1B11) - Azide and BSA Free

• Female-lethal(2)D homolog
• hFL(2)D
• KIAA0105DKFZp686F20131
• MGC3925
• PNAS-132
• pre-mRNA-splicing regulator WTAP
• putative pre-mRNA splicing regulator female-lethal(2D)
• Wilms tumor 1 associated protein
• Wilms tumor 1-associating protein
• Wilms' tumour 1-associating protein
• WT1-associated protein

Background

The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in three transcript variants, two of which encode the same isoform. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WTAP
• Entrez:
  • 9589(Human)
• Uniprot:
  • NP_690596(Human)