| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WT1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for WT1 Antibody (NBP2-58681)Find related products by research area.
|
|
Routine WT1 Antibody Screen Uncovers an Exciting New Cancer-Cleaning Enzyme Enzyme antibodies are widely used in both apoptosis and cancer studies, as disruption of the proteins regulating apoptosis is known to lead to formation of tumor cells in certain cancers. We at Novus Biologicals are continually growing our enzyme anti... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | WT1 |