Wnt-5a Antibody (3A4)

Images

 
Immunohistochemistry-Paraffin: Wnt-5a Antibody (3A4) [H00007474-M04] - Analysis of monoclonal antibody to WNT5A on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
ELISA: Wnt-5a Antibody (3A4) [H00007474-M04] - Detection limit for recombinant GST tagged WNT5A is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IHC-P
Clone
3A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Wnt-5a Antibody (3A4) Summary

Immunogen
WNT5A (AAH64694 201 a.a. - 300 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
Specificity
Reacts with wingless-type MMTV integration site family, member 5A.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
WNT5A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
This antibody is reactive against recombinant protein in ELISA.
Publications
Read Publication using H00007474-M04.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Wnt-5a Antibody (3A4)

  • hWNT5A
  • protein Wnt-5a
  • wingless-type MMTV integration site family, member 5A
  • WNT-5A protein
  • Wnt5a
  • Wnt-5a

Background

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF475
Species: Mu
Applications: WB, IHC
645-WN/CF
Species: Hu, Mu
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
AF2064
Species: Hu
Applications: WB, Simple Western
NBP2-46367
Species: Hu
Applications: WB, IHC
AF1620
Species: Mu
Applications: WB, IHC
NBP1-31406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33842
Species: Hu
Applications: ICC/IF, IHC, IHC-P
3008-WN/CF
Species: Hu
AF1617
Species: Hu
Applications: WB
AF1120
Species: Mu
Applications: WB, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
H00007474-M04
Species: Hu
Applications: ELISA, IHC-P

Publications for Wnt-5a Antibody (H00007474-M04)(1)

Reviews for Wnt-5a Antibody (H00007474-M04) (0)

There are no reviews for Wnt-5a Antibody (H00007474-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Wnt-5a Antibody (H00007474-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Wnt-5a Products

Bioinformatics Tool for Wnt-5a Antibody (H00007474-M04)

Discover related pathways, diseases and genes to Wnt-5a Antibody (H00007474-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt-5a Antibody (H00007474-M04)

Discover more about diseases related to Wnt-5a Antibody (H00007474-M04).
 

Pathways for Wnt-5a Antibody (H00007474-M04)

View related products by pathway.

PTMs for Wnt-5a Antibody (H00007474-M04)

Learn more about PTMs related to Wnt-5a Antibody (H00007474-M04).
 

Research Areas for Wnt-5a Antibody (H00007474-M04)

Find related products by research area.

Blogs on Wnt-5a

There are no specific blogs for Wnt-5a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Wnt-5a Antibody (3A4) and receive a gift card or discount.

Bioinformatics

Gene Symbol WNT5A
Entrez
Uniprot