Wnt-10b Antibody - BSA Free

Immunohistochemistry-Paraffin: Wnt-10b Antibody [NBP2-49165] - Staining in human cerebral cortex and pancreas tissues using anti-WNT10B antibody. Corresponding WNT10B RNA-seq data are presented for the same tissues.

Western Blot: Wnt-10b Antibody [NBP2-49165] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: Wnt-10b Antibody [NBP2-49165] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: Wnt-10b Antibody [NBP2-49165] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Wnt-10b Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPGPQDTWEWGGCNHDMDFGEKFS
• Predicted Species: Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WNT10B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Wnt-10b Recombinant Protein Antigen (NBP2-49165PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Wnt-10b Antibody - BSA Free

• protein Wnt-10b
• Protein Wnt-12
• SHFM6WNT-10B protein
• wingless-type MMTV integration site family, member 10B
• Wnt10b
• Wnt-10b
• WNT12
• Wnt-12

Background

Researchers have indicated that they want access to novel target antibodies quickly to aid in their research. Novus is pleased to offer researchers access to products that are not fully characterized or validated. This antibody is shown by Peptide ELISA to bind to the peptide used as immunogen. Investigators should empirically determine the suitability of the antibody, including optimal dilutions, for other applications of interest. * We cannot guarantee that this antibody will work in any application other than in a Peptide ELISA against the peptide used as immunogen and therefore can not offer a refund if the antibody does not work in your application. * The antibody is offered at a lower price compared to more highly validated antibodies. * We are not able to provide the peptide used as immunogen for this product. As this antibody is not fully validated we appreciate your feedback. Customer feedback is used to help generate testing methodologies which can lead to further product validation or withdrawal.__________________________ Wnts comprise a family of secreted signaling proteins that regulate diverse developmental processes. Activation of Wnt signaling by Wnt10b inhibits differentiation of preadipocytes and blocks adipose tissue development. In bone development, Wnt10b shifts cell fate toward the osteoblast lineage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Wnt-10b Antibody (NBP2-49165)(1)

Publication using NBP2-49165

• Chen-Yuan Hsiao, Tien-Hua Chen, Tzu-Hui Chu, Yen-Nien Ting, Pei-Jiun Tsai, Jia-Fwu Shyu Calcitonin Induces Bone Formation by Increasing Expression of Wnt10b in Osteoclasts in Ovariectomy-Induced Osteoporotic Rats Frontiers in Endocrinology 2020-09-08 [PMID: 33013696]

Bioinformatics

• Gene Symbol: WNT10B