WDR9 Antibody - BSA Free

Immunohistochemistry-Paraffin: WDR9 Antibody [NBP1-89878] - Staining of human Kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: WDR9 Antibody [NBP1-89878] - Staining of human Cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: WDR9 Antibody [NBP1-89878] - Staining of human Endometrium shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: WDR9 Antibody [NBP1-89878] - Staining of human Liver shows strong cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WDR9 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RTRAAQRKTGPVSLANGCGRKATRKRVYLSDSDNNSLETGEILKARAGNNRKVLRKCAAVAANKIKLMSDVEENSSSESVCSGRKLPHRNASAVA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BRWD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  WDR9 Protein (NBP1-89878PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for WDR9 Antibody - BSA Free

• bromodomain and WD repeat domain containing 1
• bromodomain and WD repeat-containing protein 1
• C21orf107
• chromosome 21 open reading frame 107
• FLJ11315
• FLJ43918
• N143
• transcriptional unit N143
• WD repeat domain 9
• WD repeat protein WDR9-form2
• WD repeat-containing protein 9
• WDR9

Background

WDR9 encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 2 bromodomains and multiple WD repeats, and the function of this protein is not known. This gene is located within the Down syndrome region-2 on chromosome 21. Alternative splicing of this gene generates 3 transcript variants diverging at the 3' ends.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BRWD1