WDR9 Antibody

Images

 
Western Blot: WDR9 Antibody [NBP1-89878] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HELA
Immunohistochemistry-Paraffin: WDR9 Antibody [NBP1-89878] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RTRAAQRKTGPVSLANGCGRKATRKRVYLSDSDNNSLETGEILKARAGNNRKVLRKCAAVAANKIKLMSDVEENSSSESVCSGRKLPHRNASAVA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BRWD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WDR9 Protein (NBP1-89878PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR9 Antibody

  • bromodomain and WD repeat domain containing 1
  • bromodomain and WD repeat-containing protein 1
  • C21orf107
  • chromosome 21 open reading frame 107
  • FLJ11315
  • FLJ43918
  • N143
  • transcriptional unit N143
  • WD repeat domain 9
  • WD repeat protein WDR9-form2
  • WD repeat-containing protein 9
  • WDR9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-57712
Species: Hu
Applications: ICC/IF
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88436
Species: Hu
Applications: WB, IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-84492
Species: Hu
Applications: IHC, IHC-P
MAB195
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-45856
Species: Hu
Applications: WB, IHC, IF
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for WDR9 Antibody (NBP1-89878) (0)

There are no publications for WDR9 Antibody (NBP1-89878).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR9 Antibody (NBP1-89878) (0)

There are no reviews for WDR9 Antibody (NBP1-89878). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR9 Antibody (NBP1-89878) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDR9 Products

Bioinformatics Tool for WDR9 Antibody (NBP1-89878)

Discover related pathways, diseases and genes to WDR9 Antibody (NBP1-89878). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR9 Antibody (NBP1-89878)

Discover more about diseases related to WDR9 Antibody (NBP1-89878).
 

Pathways for WDR9 Antibody (NBP1-89878)

View related products by pathway.

Blogs on WDR9

There are no specific blogs for WDR9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BRWD1