WDR37 Antibody

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: WDR37 Antibody [NBP1-81450] - Staining of human cerebral cortex, kidney, liver and lymph node using Anti-WDR37 antibody NBP1-81450 (A) shows similar protein ...read more
Western Blot: WDR37 Antibody [NBP1-81450] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: WDR37 Antibody [NBP1-81450] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
Western Blot: WDR37 Antibody [NBP1-81450] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: WDR37 Antibody [NBP1-81450] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: WDR37 Antibody [NBP1-81450] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: WDR37 Antibody [NBP1-81450] - Staining of human liver shows weak positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

WDR37 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FRDPSIHSVNVFQGHTDTVTSAVFTVGDNVVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRINVCVGQKIIALPHDNRQVRLFDMSGVRLARLPRSSRQGHRRMVCCS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR37
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WDR37 Protein (NBP1-81450PEP)
Publications
Read Publication using NBP1-81450.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR37 Antibody

  • KIAA0982FLJ40354
  • RP11-529L18.2
  • WD repeat domain 37
  • WD repeat-containing protein 37

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-42216
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86019
Species: Hu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-93502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-1872
Species: Hu, Mu, Rt
Applications: WB, Flow
NBP2-03396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27192
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC, IHC-P
NBP2-93638
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-31862
Species: Hu
Applications: IHC, IHC-P
NBP1-89324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-88806
Species: Hu
Applications: WB, IHC, IHC-P
NB100-97823
Species: Hu
Applications: WB, ICC/IF, IP
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP2-38698
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31800
Species: Hu
Applications: WB, IHC, IHC-P

Publications for WDR37 Antibody (NBP1-81450)(1)

Reviews for WDR37 Antibody (NBP1-81450) (0)

There are no reviews for WDR37 Antibody (NBP1-81450). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR37 Antibody (NBP1-81450) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional WDR37 Products

Bioinformatics Tool for WDR37 Antibody (NBP1-81450)

Discover related pathways, diseases and genes to WDR37 Antibody (NBP1-81450). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR37 Antibody (NBP1-81450)

Discover more about diseases related to WDR37 Antibody (NBP1-81450).
 

Pathways for WDR37 Antibody (NBP1-81450)

View related products by pathway.

Blogs on WDR37

There are no specific blogs for WDR37, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR37 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR37