WBP2NL Antibody - BSA Free

Western Blot: WBP2NL Antibody [NBP3-35874] - Western blot analysis of lysates from Rat spleen, using WBP2NL Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WBP2NL Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit WBP2NL Antibody - BSA Free (NBP3-35874) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human WBP2NL (NP_689826.2).
  
  Sequence:
  MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WBP2NL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for WBP2NL Antibody - BSA Free

• MGC26816
• PAWPFLJ26145
• postacrosomal sheath WW domain-binding protein
• WBP2 N-terminal like
• WW domain-binding protein 2-like

Background

Regulated by GSTP1 and playing a role in cell activation, WBP2NL is a sperm-specific WW domain-binding protein. It promotes meiotic resumption and may play a role in pronuclear formation during oocyte fertilization. Other biological processes involved with WBP2NL include egg activation, female pronucleus assembly and male pronucleus assembly. Mitral valve stenosis, cerebrovascular accident and pulmonary edema are diseases associated with WBP2NL.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WBP2NL