WASF1/WAVE1 Antibody

Images

 
Western Blot: WASF1/WAVE1 Antibody [NBP1-83018] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HEL
Immunohistochemistry: WASF1/WAVE1 Antibody [NBP1-83018] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WASF1/WAVE1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSATGLIENRPQSPATGRTPVFVSPTP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WASF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WASF1/WAVE1 Protein (NBP1-83018PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WASF1/WAVE1 Antibody

  • KIAA0269WAVEhomology of dictyostelium scar 1
  • Protein WAVE-1
  • SCAR1
  • SCAR1WASP family protein member 1
  • Verprolin homology domain-containing protein 1
  • WAS protein family, member 1
  • WASF1
  • WASP1
  • WAVE1
  • WAVE1FLJ31482
  • wisk

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2307
Species: Hu
Applications: WB
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37912
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5515
Species: Hu, Mu
Applications: WB
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-59845
Species: Hu
Applications: IP (-), WB, IHC-P
NBP2-14424
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57026
Species: Hu
Applications: ICC/IF
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16060
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP1-88391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for WASF1/WAVE1 Antibody (NBP1-83018) (0)

There are no publications for WASF1/WAVE1 Antibody (NBP1-83018).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WASF1/WAVE1 Antibody (NBP1-83018) (0)

There are no reviews for WASF1/WAVE1 Antibody (NBP1-83018). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WASF1/WAVE1 Antibody (NBP1-83018) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WASF1/WAVE1 Products

Bioinformatics Tool for WASF1/WAVE1 Antibody (NBP1-83018)

Discover related pathways, diseases and genes to WASF1/WAVE1 Antibody (NBP1-83018). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WASF1/WAVE1 Antibody (NBP1-83018)

Discover more about diseases related to WASF1/WAVE1 Antibody (NBP1-83018).
 

Pathways for WASF1/WAVE1 Antibody (NBP1-83018)

View related products by pathway.

PTMs for WASF1/WAVE1 Antibody (NBP1-83018)

Learn more about PTMs related to WASF1/WAVE1 Antibody (NBP1-83018).

Blogs on WASF1/WAVE1

There are no specific blogs for WASF1/WAVE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WASF1/WAVE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WASF1
Entrez