NAA25 Antibody

Images

 
Western Blot: NAA25 Antibody [NBP1-88391] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: NAA25 Antibody [NBP1-88391] - Staining of human cell line U-2 OS shows positivity in cytoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: NAA25 Antibody [NBP1-88391] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAA25 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAA25
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NAA25 Protein (NBP1-88391PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NAA25 Antibody

  • C12orf30DKFZp667K2112
  • chromosome 12 open reading frame 30
  • FLJ13089
  • MDM20mitochondrial distribution and morphology 20
  • Mitochondrial distribution and morphology protein 20
  • N(alpha)-acetyltransferase 25, NatB auxiliary subunit
  • N-alpha-acetyltransferase 25, NatB auxiliary subunit
  • NAP1
  • NatB complex subunit MDM20
  • N-terminal acetyltransferase B complex subunit MDM20
  • N-terminal acetyltransferase B complex subunit NAA25
  • p120

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5514
Species: Hu, Mu
Applications: WB
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP2-57026
Species: Hu
Applications: ICC/IF
NBP2-36543
Species: Hu
Applications: WB, IP
NBP1-83269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-58095
Species: Hu
Applications: WB
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-16060
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP2-57502
Species: Hu
Applications: ICC/IF
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NAA25 Antibody (NBP1-88391) (0)

There are no publications for NAA25 Antibody (NBP1-88391).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAA25 Antibody (NBP1-88391) (0)

There are no reviews for NAA25 Antibody (NBP1-88391). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NAA25 Antibody (NBP1-88391) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAA25 Products

Bioinformatics Tool for NAA25 Antibody (NBP1-88391)

Discover related pathways, diseases and genes to NAA25 Antibody (NBP1-88391). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAA25 Antibody (NBP1-88391)

Discover more about diseases related to NAA25 Antibody (NBP1-88391).

Blogs on NAA25

There are no specific blogs for NAA25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAA25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAA25