WARS2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: WARS2 Antibody [NBP3-17325] - Staining of human cell line HEK 293 shows localization to nucleoplasm & mitochondria.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WARS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit WARS2 Antibody - BSA Free (NBP3-17325) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VSNIVAVHAAVTGLSVEEVVRRSAGMNTARYKLAVADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WARS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for WARS2 Antibody - BSA Free

• (Mt)TrpRS
• EC 6.1.1
• EC 6.1.1.2
• TrpRStryptophan-tRNA ligase
• tryptophan tRNA ligase 2, mitochondrial
• Tryptophan--tRNA ligase
• tryptophanyl tRNA synthetase 2, mitochondrial
• tryptophanyl-tRNA synthetase, mitochondrial

Background

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. This gene encodes the mitochondrial tryptophanyl-tRNA synthetase. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WARS2