VSIG2 Antibody - BSA Free

Immunohistochemistry-Paraffin: VSIG2 Antibody [NBP2-48955] -Analysis in human stomach and skeletal muscle tissues using NBP2-48955antibody. Corresponding VSIG2 RNA-seq data are presented for the same tissues.

Western Blot: VSIG2 Antibody [NBP2-48955] - Analysis in control (vector only transfected HEK293T lysate) and VSIG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry: VSIG2 Antibody [NBP2-48955] - Staining of human stomach, upper shows strong cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: VSIG2 Antibody [NBP2-48955] -Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: VSIG2 Antibody [NBP2-48955] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: VSIG2 Antibody [NBP2-48955] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VSIG2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GKKPKETYGGSDLREDAIAPGISEHTCMRADSSKGFLERPSSASTVTTTKSKLPMVV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VSIG2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  VSIG2 Recombinant Protein Antigen (NBP2-48955PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for VSIG2 Antibody - BSA Free

• 2210413P10Rik
• Cortical thymocyte-like protein
• CTH
• CTHCTXLcortical thymocyte receptor (X. laevis CTX) like
• CT-like protein
• CTXL
• V-set and immunoglobulin domain containing 2
• V-set and immunoglobulin domain-containing protein 2
• VSIG2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VSIG2