VPS52 Antibody

Images

 
Immunohistochemistry: VPS52 Antibody [NBP2-30418] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS52 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VPS52
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VPS52 Protein (NBP2-30418PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VPS52 Antibody

  • ARE1
  • dJ1033B10.5
  • DKFZp547I194
  • SAC2 suppressor of actin mutations 2-like (yeast)
  • SAC2 suppressor of actin mutations 2-like protein
  • SAC2
  • SACM2LRP5-1033B10
  • vacuolar protein sorting 52 (yeast)
  • vacuolar protein sorting 52 homolog (S. cerevisiae)
  • vacuolar protein sorting-associated protein 52 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-57268
Species: Hu
Applications: WB, ICC/IF
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-83798
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-84423
Species: Hu
Applications: IHC, IHC-P
NBP2-24664
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP2-13263
Species: Hu
Applications: WB, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03319
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA

Publications for VPS52 Antibody (NBP2-30418) (0)

There are no publications for VPS52 Antibody (NBP2-30418).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS52 Antibody (NBP2-30418) (0)

There are no reviews for VPS52 Antibody (NBP2-30418). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for VPS52 Antibody (NBP2-30418) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VPS52 Products

Bioinformatics Tool for VPS52 Antibody (NBP2-30418)

Discover related pathways, diseases and genes to VPS52 Antibody (NBP2-30418). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS52 Antibody (NBP2-30418)

Discover more about diseases related to VPS52 Antibody (NBP2-30418).
 

Pathways for VPS52 Antibody (NBP2-30418)

View related products by pathway.

PTMs for VPS52 Antibody (NBP2-30418)

Learn more about PTMs related to VPS52 Antibody (NBP2-30418).
 

Research Areas for VPS52 Antibody (NBP2-30418)

Find related products by research area.

Blogs on VPS52

There are no specific blogs for VPS52, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS52 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS52
Uniprot