VPS37C Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: VPS37C Antibody [NBP1-83632] - Staining of human cell line U-2 OS shows positivity in vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: VPS37C Antibody [NBP1-83632] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VPS37C Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KIEEESEAMAEKFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VPS37C
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  VPS37C Protein (NBP1-83632PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for VPS37C Antibody - BSA Free

• ESCRT-I complex subunit VPS37C
• FLJ20847
• hVps37C
• PML39
• vacuolar protein sorting 37 homolog C (S. cerevisiae)
• vacuolar protein sorting 37C (yeast)
• vacuolar protein sorting 37C
• vacuolar protein sorting-associated protein 37C

Background

VPS37C is a subunit of ESCRT-I (endosomal sorting complex required for transport I), a complex in the class E vacuolar protein sorting (VPS) pathway required for sorting ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies (Eastman et al., 2005).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VPS37C