VPS37C Antibody

Images

 
Immunohistochemistry: VPS37C Antibody [NBP1-83632] - Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunofluorescence: VPS37C Antibody [NBP1-83632] - Staining of human cell line U-2 OS shows positivity in vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS37C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KIEEESEAMAEKFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VPS37C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunofluorescence 1-4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VPS37C Protein (NBP1-83632PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VPS37C Antibody

  • ESCRT-I complex subunit VPS37C
  • FLJ20847
  • hVps37C
  • PML39
  • vacuolar protein sorting 37 homolog C (S. cerevisiae)
  • vacuolar protein sorting 37C (yeast)
  • vacuolar protein sorting 37C
  • vacuolar protein sorting-associated protein 37C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-83528
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NBP1-85976
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-80651
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP1-82283
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
NB100-2468
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-84158
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83726
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91882
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for VPS37C Antibody (NBP1-83632) (0)

There are no publications for VPS37C Antibody (NBP1-83632).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS37C Antibody (NBP1-83632) (0)

There are no reviews for VPS37C Antibody (NBP1-83632). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VPS37C Antibody (NBP1-83632) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VPS37C Products

VPS37C NBP1-83632

Bioinformatics Tool for VPS37C Antibody (NBP1-83632)

Discover related pathways, diseases and genes to VPS37C Antibody (NBP1-83632). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS37C Antibody (NBP1-83632)

Discover more about diseases related to VPS37C Antibody (NBP1-83632).
 

Pathways for VPS37C Antibody (NBP1-83632)

View related products by pathway.

PTMs for VPS37C Antibody (NBP1-83632)

Learn more about PTMs related to VPS37C Antibody (NBP1-83632).

Blogs on VPS37C

There are no specific blogs for VPS37C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS37C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS37C