VPS36 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: VPS36 Antibody [NBP2-13518] - Staining of human cell line U-2 OS shows localization to vesicles & lysosomes.
Immunohistochemistry-Paraffin: VPS36 Antibody [NBP2-13518] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS36 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLS EEMTQRRWENMPVSQSLQTNRG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VPS36
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VPS36 Protein (NBP2-13518PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VPS36 Antibody

  • C13orf9
  • CGI-145
  • DKFZp781E0871
  • Eap45
  • EAP45chromosome 13 open reading frame 9
  • ELL-associated protein of 45 kDa
  • ELL-associated protein, 45 kDa
  • ESCRT-II complex subunit VPS36
  • vacuolar protein sorting 36 homolog (S. cerevisiae)
  • vacuolar protein sorting 36 homolog (yeast)
  • vacuolar protein-sorting-associated protein 36

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2468
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-83726
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP1-85976
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB110-87320
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
NBP2-58195
Species: Hu
Applications: ICC/IF
NBP2-13518
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for VPS36 Antibody (NBP2-13518) (0)

There are no publications for VPS36 Antibody (NBP2-13518).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS36 Antibody (NBP2-13518) (0)

There are no reviews for VPS36 Antibody (NBP2-13518). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for VPS36 Antibody (NBP2-13518) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VPS36 Products

Bioinformatics Tool for VPS36 Antibody (NBP2-13518)

Discover related pathways, diseases and genes to VPS36 Antibody (NBP2-13518). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS36 Antibody (NBP2-13518)

Discover more about diseases related to VPS36 Antibody (NBP2-13518).
 

Pathways for VPS36 Antibody (NBP2-13518)

View related products by pathway.

PTMs for VPS36 Antibody (NBP2-13518)

Learn more about PTMs related to VPS36 Antibody (NBP2-13518).

Blogs on VPS36

There are no specific blogs for VPS36, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS36 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS36