VPS16 Antibody

Images

 
Western Blot: VPS16 Antibody [NBP2-48785] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry: VPS16 Antibody [NBP2-48785] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS16 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AADAFYKAKNEFAAKATEDQMRLLRLQRRLEDELGGQFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYLP
Specificity
Specificity of human VPS16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VPS16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VPS16 Recombinant Protein Antigen (NBP2-48785PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VPS16 Antibody

  • hVPS16
  • vacuolar protein sorting 16 homolog (S. cerevisiae)
  • vacuolar protein sorting protein 16
  • vacuolar protein sorting-associated protein 16 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82906
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47583
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65376
Species: Hu
NBP1-81639
Species: Hu
Applications: WB, IHC, IHC-P
MAB1448
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
NBP1-76535
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00023355-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81642
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20874
Species: Hu
Applications: WB, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready

Publications for VPS16 Antibody (NBP2-48785) (0)

There are no publications for VPS16 Antibody (NBP2-48785).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS16 Antibody (NBP2-48785) (0)

There are no reviews for VPS16 Antibody (NBP2-48785). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS16 Antibody (NBP2-48785) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for VPS16 Antibody (NBP2-48785)

Discover related pathways, diseases and genes to VPS16 Antibody (NBP2-48785). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS16 Antibody (NBP2-48785)

Discover more about diseases related to VPS16 Antibody (NBP2-48785).
 

Pathways for VPS16 Antibody (NBP2-48785)

View related products by pathway.

PTMs for VPS16 Antibody (NBP2-48785)

Learn more about PTMs related to VPS16 Antibody (NBP2-48785).

Blogs on VPS16.

UVRAG - A regulator of membrane trafficking in autophagy and endocytosis
UV resistance-associated gene (UVRAG) is a tumor suppressor that is commonly mutated in colon and breast cancer. While UVRAG was discovered for its ability to complement UV sensitivity in xeroderma pigmentosum cells, its main functions are in auto...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS16