VPS18 Antibody

Images

 
Western Blot: VPS18 Antibody [NBP1-82906] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: VPS18 Antibody [NBP1-82906] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS18 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LYVNRNGQKVRPLARWKGQLVESVGWNKALGTESSTGPILVGTAQGHIFEAELSASEGGLFGPAPDLYFRPLYVLNEEGGPAPVCSLEAERGPDGRSFVIATT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VPS18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VPS18 Protein (NBP1-82906PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VPS18 Antibody

  • hVPS18
  • KIAA1475PEP3
  • vacuolar protein sorting 18 homolog (S. cerevisiae)
  • vacuolar protein sorting protein 18
  • vacuolar protein sorting-associated protein 18 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2412
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-48785
Species: Hu
Applications: WB, IHC
NBP2-44235
Species: Ce, Pl
Applications: WB, ELISA, IHC
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-86731
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1448
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-81639
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76535
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15078
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00023355-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-57242
Species: Hu
Applications: WB, ICC/IF

Publications for VPS18 Antibody (NBP1-82906) (0)

There are no publications for VPS18 Antibody (NBP1-82906).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS18 Antibody (NBP1-82906) (0)

There are no reviews for VPS18 Antibody (NBP1-82906). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS18 Antibody (NBP1-82906) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VPS18 Products

Bioinformatics Tool for VPS18 Antibody (NBP1-82906)

Discover related pathways, diseases and genes to VPS18 Antibody (NBP1-82906). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS18 Antibody (NBP1-82906)

Discover more about diseases related to VPS18 Antibody (NBP1-82906).
 

Pathways for VPS18 Antibody (NBP1-82906)

View related products by pathway.

PTMs for VPS18 Antibody (NBP1-82906)

Learn more about PTMs related to VPS18 Antibody (NBP1-82906).
 

Research Areas for VPS18 Antibody (NBP1-82906)

Find related products by research area.

Blogs on VPS18

There are no specific blogs for VPS18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS18