Vitronectin Antibody (2V2V8) Summary
| Description |
Novus Biologicals Rabbit Vitronectin Antibody (2V2V8) (NBP3-16498) is a recombinant monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 379-478 of human Vitronectin (P04004). YRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
VTN |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
54 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Vitronectin Antibody (2V2V8)
Background
Vitronectin also called serum spreading factor or complement S-protein, is a member of the pexin family (1). Found in serum and in tissues, Vitronectin exist in two forms; as a single chain (75kDa) and as a clipped form composed of two chains (65kDa and 10kDa). Vitronectin promotes cell adhesion, spreading and migration through specific interactions with cellular integrins, and inhibits cytolysis by the complement C5b-9 complex (2-4). Vitronectin also interacts with several critical proteins that regulate thrombosis and fibrinolysis. Vitronectin is phosphorylated by PKA and CKII (5).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC, IP
Species: Hu
Applications: IHC, KO, Simple Western, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: BA
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Publications for Vitronectin Antibody (NBP3-16498) (0)
There are no publications for Vitronectin Antibody (NBP3-16498).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Vitronectin Antibody (NBP3-16498) (0)
There are no reviews for Vitronectin Antibody (NBP3-16498).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Vitronectin Antibody (NBP3-16498) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Vitronectin Products
Research Areas for Vitronectin Antibody (NBP3-16498)
Find related products by research area.
|
Blogs on Vitronectin