VIPAR Antibody


Western Blot: VIPAR Antibody [NBP2-88575] - Host: Rabbit. Target Name: SPE39. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

VIPAR Antibody Summary

The immunogen is a synthetic peptide directed towards the N-terminal region of Human VIPAR. Peptide sequence: DTPAKSYAPELGRPKGEYRDYSNDWSPSDTVRRLRKGKVCSLERFRSLQD The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for VIPAR Antibody

  • C14orf133FLJ12707
  • hSPE-39
  • Protein spe-39 homolog
  • SPE-39
  • SPE39chromosome 14 open reading frame 133
  • VPS16B
  • VPS33B interacting protein, apical-basolateral polarity regulator
  • VPS33B-interacting protein involved in polarity and apical protein restriction
  • VPS33B-interacting protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Mu
Applications: ICC, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for VIPAR Antibody (NBP2-88575) (0)

There are no publications for VIPAR Antibody (NBP2-88575).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VIPAR Antibody (NBP2-88575) (0)

There are no reviews for VIPAR Antibody (NBP2-88575). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VIPAR Antibody (NBP2-88575) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional VIPAR Products

Bioinformatics Tool for VIPAR Antibody (NBP2-88575)

Discover related pathways, diseases and genes to VIPAR Antibody (NBP2-88575). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on VIPAR

There are no specific blogs for VIPAR, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our VIPAR Antibody and receive a gift card or discount.


Gene Symbol VIPAS39