VIP Antibody

Images

 
Immunohistochemistry: VIP Antibody [NBP1-86446] - Staining of human pancreas shows distinct cytoplasmic positivity in islet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VIP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH6 retrieval is recommended.
Control Peptide
VIP Protein (NBP1-86446PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VIP Antibody

  • MGC13587
  • PHM27
  • vasoactive intestinal peptide
  • VIP peptides
  • VIP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4375
Species: Hu, Mu, Rt
Applications: IHC
AF6380
Species: Mu
Applications: WB
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-31619
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48988
Species: Hu
Applications: IHC
MAB4077
Species: Hu
Applications: WB, IHC
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-86446
Species: Hu
Applications: IHC, IHC-P

Publications for VIP Antibody (NBP1-86446) (0)

There are no publications for VIP Antibody (NBP1-86446).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VIP Antibody (NBP1-86446) (0)

There are no reviews for VIP Antibody (NBP1-86446). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for VIP Antibody (NBP1-86446) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VIP Products

Bioinformatics Tool for VIP Antibody (NBP1-86446)

Discover related pathways, diseases and genes to VIP Antibody (NBP1-86446). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VIP Antibody (NBP1-86446)

Discover more about diseases related to VIP Antibody (NBP1-86446).
 

Pathways for VIP Antibody (NBP1-86446)

View related products by pathway.

PTMs for VIP Antibody (NBP1-86446)

Learn more about PTMs related to VIP Antibody (NBP1-86446).

Blogs on VIP

There are no specific blogs for VIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VIP
Entrez
Uniprot