VGLL3 Antibody

Images

 
Western Blot: VGLL3 Antibody [H00389136-B01P] - Analysis of VGLL3 expression in transfected 293T cell line by VGLL3 polyclonal antibody. Lane 1: VGLL3 transfected lysate(35.2 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

VGLL3 Antibody Summary

Immunogen
VGLL3 (AAH94780.1, 1 a.a. - 320 a.a.) full-length human protein. MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGWSAMARS
Specificity
VGLL3 - vestigial like 3 (Drosophila),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
VGLL3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VGLL3 Antibody

  • colon carcinoma related protein
  • DKFZp686O1845
  • FLJ38507
  • transcription cofactor vestigial-like protein 3
  • vestigial like 3 (Drosophila)
  • vestigial-like 3
  • VGL3
  • VGL-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7509
Species: Hu
Applications: IHC, WB
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
AF-242-PB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-31921
Species: Hu
Applications: IHC, IHC-P
NBP2-44245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-52105
Species: Hu, Rt
Applications: Flow, IHC, IHC-P, PEP-ELISA, WB
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00245806-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-92273
Species: Hu, Mu
Applications: IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
291-G1
Species: Hu
Applications: BA
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP2-13754
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
NB300-561
Species: Bv, Eq, Ha, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00389136-B01P
Species: Hu
Applications: WB

Publications for VGLL3 Antibody (H00389136-B01P) (0)

There are no publications for VGLL3 Antibody (H00389136-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VGLL3 Antibody (H00389136-B01P) (0)

There are no reviews for VGLL3 Antibody (H00389136-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VGLL3 Antibody (H00389136-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VGLL3 Products

Bioinformatics Tool for VGLL3 Antibody (H00389136-B01P)

Discover related pathways, diseases and genes to VGLL3 Antibody (H00389136-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VGLL3 Antibody (H00389136-B01P)

Discover more about diseases related to VGLL3 Antibody (H00389136-B01P).
 

Pathways for VGLL3 Antibody (H00389136-B01P)

View related products by pathway.

Blogs on VGLL3

There are no specific blogs for VGLL3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VGLL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VGLL3
Entrez
Uniprot