VDAC2 Antibody (3D2)

Images

 
Western Blot: VDAC2 Antibody (3D2) [H00007417-M01] - VDAC2 monoclonal antibody (M01), clone 3D2. Analysis of VDAC2 expression in rat brain.
Immunocytochemistry/ Immunofluorescence: VDAC2 Antibody (3D2) [H00007417-M01] - Analysis of monoclonal antibody to VDAC2 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: VDAC2 Antibody (3D2) [H00007417-M01] - VDAC2 monoclonal antibody (M01), clone 3D2. Analysis of VDAC2 expression in K-562.
Western Blot: VDAC2 Antibody (3D2) [H00007417-M01] - Analysis of VDAC2 expression in transfected 293T cell line by VDAC2 monoclonal antibody (M01), clone 3D2.Lane 1: VDAC2 transfected lysate(31.6 KDa).Lane 2: ...read more
Sandwich ELISA: VDAC2 Antibody (3D2) [H00007417-M01] - Detection limit for recombinant GST tagged VDAC2 is 10 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
3D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

VDAC2 Antibody (3D2) Summary

Immunogen
VDAC2 (AAH00165, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
Specificity
VDAC2 - voltage-dependent anion channel 2 (3D2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VDAC2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.
Publications
Read Publication using H00007417-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VDAC2 Antibody (3D2)

  • FLJ23841
  • hVDAC2
  • Outer mitochondrial membrane protein porin 2
  • POR
  • VDAC-2
  • voltage-dependent anion channel 2
  • voltage-dependent anion-selective channel protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-695
Species: Hu, Mu, Rt, Fi
Applications: WB, ELISA, IHC, KD
NBP1-80070
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-67460
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38698
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82845
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1596
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-85740
Species: Hu, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for VDAC2 Antibody (H00007417-M01)(1)


Showing Publication 1 - 1 of 1.
Publication using H00007417-M01 Applications Species
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018

Reviews for VDAC2 Antibody (H00007417-M01) (0)

There are no reviews for VDAC2 Antibody (H00007417-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VDAC2 Antibody (H00007417-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional VDAC2 Products

Bioinformatics Tool for VDAC2 Antibody (H00007417-M01)

Discover related pathways, diseases and genes to VDAC2 Antibody (H00007417-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VDAC2 Antibody (H00007417-M01)

Discover more about diseases related to VDAC2 Antibody (H00007417-M01).
 

Pathways for VDAC2 Antibody (H00007417-M01)

View related products by pathway.

PTMs for VDAC2 Antibody (H00007417-M01)

Learn more about PTMs related to VDAC2 Antibody (H00007417-M01).

Blogs on VDAC2

There are no specific blogs for VDAC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VDAC2 Antibody (3D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol VDAC2
Entrez
Uniprot