VAV3 Antibody - BSA Free

Western Blot: VAV3 Antibody [NBP2-86891] - Host: Rabbit. Target Name: VAV3. Sample Type: Fetal Lung. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

VAV3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit VAV3 Antibody - BSA Free (NBP2-86891) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human VAV3. Peptide sequence: EIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLKKK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VAV3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for VAV3 Antibody - BSA Free

• FLJ40431
• guanine nucleotide exchange factor VAV3
• vav 3 guanine nucleotide exchange factor
• vav 3 oncogene
• VAV-3

Background

The Vav family are Rho/Rac guanosine nucleotide exchange factors (GEFs), consisting of three members in mammalian cells (Vav, Vav2, Vav3) and one in nematodes (CelVav) (1). Vav3 is expressed in most hematopoietic cells and non-hematopoietic tissues except ovary and skeletal muscles. T-cell stimulated and tyrosine phosphorylated Vav3 acts as an exchange factor for GTP-binding proteins RhoA, RhoG, and Rac1 (2). Also, tyrosine phosphorylated Vav3 mediates RTK signalizing, specifically IR, IGFR, and EGFR-mediated signaling pathways. Vav3 has been linked to as a factor for cell morphology modulation and an inducer for cell transformation (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VAV3