We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Vav-1 Recombinant Protein Antigen

Images

 
There are currently no images for Vav-1 Recombinant Protein Antigen (NBP1-86867PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Vav-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VAV1.

Source: E. coli

Amino Acid Sequence: LSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRSEPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VAV1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86867.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Vav-1 Recombinant Protein Antigen

  • oncogene vav
  • proto-oncogene vav
  • vav 1 guanine nucleotide exchange factor
  • vav proto-oncogene
  • Vav1
  • Vav-1
  • vav-T
  • VAVvav 1 oncogene

Background

The Vav family are Rho/Rac guanosine nucleotide exchange factors (GEFs), consisting of three members in mammalian cells (Vav, Vav2, Vav3) and one in nematodes (CelVav) (1). First discovered based on its transforming properties, Vav is expressed mainly in hematopoietic cells and a few non-hematopoietic tissues, such as the pancreas and tooth enamels (2). As a signaling transducer, Vav is involved in T-cell activated transduction of T-cell antigen receptor (TCR). T-cell stimulated and tyrosine phosphorylated Vav acts as a catalyst in the exchange of guanosine nucleotides on Rac-1, a GTP binding protein (3). Using a mouse model, Vav expression has been determined to play an essential role in the cyctosketetal, proliferative, and apoptotic pathways for developing lymphoid cells and its signal response (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP3-21731
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF6260
Species: Hu
Applications: WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-48224
Species: Hu
Applications: IHC,  IHC-P
202-IL
Species: Hu
Applications: BA
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
MAB7474
Species: Hu
Applications: ICC, Simple Western, WB
NBP3-15638
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-32945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-23269
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
MAB7500
Species: Hu
Applications: ICC, WB
NBP2-00289
Species: Hu
Applications: Flow-CS, Flow, IHC,  IHC-P, IP, WB
NBP1-86867PEP
Species: Hu
Applications: AC

Publications for Vav-1 Recombinant Protein Antigen (NBP1-86867PEP) (0)

There are no publications for Vav-1 Recombinant Protein Antigen (NBP1-86867PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vav-1 Recombinant Protein Antigen (NBP1-86867PEP) (0)

There are no reviews for Vav-1 Recombinant Protein Antigen (NBP1-86867PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Vav-1 Recombinant Protein Antigen (NBP1-86867PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Vav-1 Products

Research Areas for Vav-1 Recombinant Protein Antigen (NBP1-86867PEP)

Find related products by research area.

Blogs on Vav-1

There are no specific blogs for Vav-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Vav-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol VAV1