Vanilloid R-like 3/TRPV3 Antibody - BSA Free Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Vanilloid R-like 3/TRPV3 (NP_659505.1). DNSVLEITVYNTNIDNRHEMLTLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVSYYRPREEEAIPHPLALTHKMGWLQLLGRMFVLIWAMCISVK |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
TRPV3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Western Blot 1:500 - 1:2000
|
Theoretical MW |
91 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Vanilloid R-like 3/TRPV3 Antibody - BSA Free
Background
Transient receptor potential (TRP) proteins are cation selective channels that function in processes as diverse as sensation and vasoregulation. TRPV3 is a receptor activated non selective calcium permeant cation channel that is activated by innocuous (warm) temperatures and shows an increased response at noxious temperatures greater than 39 degrees Celsius. TRPV3 is expressed in skin, tongue, dorsal root ganglion, trigeminal ganglion, spinal cord and brain and is thermosensitive in the physiological range of temperatures between TRPM8 and TRPV1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Gp, Hu, Mu, Rt, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
Species: Ca, Hu, Pm, Pm
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Publications for Vanilloid R-like 3/TRPV3 Antibody (NBP3-02994) (0)
There are no publications for Vanilloid R-like 3/TRPV3 Antibody (NBP3-02994).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Vanilloid R-like 3/TRPV3 Antibody (NBP3-02994) (0)
There are no reviews for Vanilloid R-like 3/TRPV3 Antibody (NBP3-02994).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Vanilloid R-like 3/TRPV3 Antibody (NBP3-02994) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Vanilloid R-like 3/TRPV3 Products
Research Areas for Vanilloid R-like 3/TRPV3 Antibody (NBP3-02994)
Find related products by research area.
|
Blogs on Vanilloid R-like 3/TRPV3