Vanilloid R-like 3/TRPV3 Antibody - BSA Free

Western Blot: Vanilloid R-like 3/TRPV3 Antibody [NBP3-02993] - Analysis of extracts of various cell lines, using Vanilloid R-like 3/TRPV3 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:Basic ECL Kit

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Vanilloid R-like 3/TRPV3 Antibody - BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Vanilloid R-like 3/TRPV3 (NP_659505.1). DNSVLEITVYNTNIDNRHEMLTLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVSYYRPREEEAIPHPLALTHKMGWLQLLGRMFVLIWAMCISVK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRPV3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Vanilloid R-like 3/TRPV3 Antibody - BSA Free

• transient receptor potential cation channel subfamily V member 3
• transient receptor potential cation channel, subfamily V, member 3
• TRPV3
• vanilloid receptor 3
• Vanilloid receptor-like 3
• vanilloid receptor-related osmotically activated channel protein
• Vanilloid R-like 3
• VanilloidR like 3
• VanilloidR-like3
• VRL3
• VRL-3

Background

Transient receptor potential (TRP) proteins are cation selective channels that function in processes as diverse as sensation and vasoregulation. TRPV3 is a receptor activated non selective calcium permeant cation channel that is activated by innocuous (warm) temperatures and shows an increased response at noxious temperatures greater than 39 degrees Celsius. TRPV3 is expressed in skin, tongue, dorsal root ganglion, trigeminal ganglion, spinal cord and brain and is thermosensitive in the physiological range of temperatures between TRPM8 and TRPV1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRPV3