Vanilloid R-like 3/TRPV3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Vanilloid R-like 3/TRPV3 Antibody [NBP2-57314] - Staining of human cell line CACO-2 shows localization to plasma membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Vanilloid R-like 3/TRPV3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETS
Specificity
Specificity of human Vanilloid R-like 3/TRPV3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRPV3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Vanilloid R-like 3/TRPV3 Recombinant Protein Antigen (NBP2-57314PEP)

Reactivity Notes

Mouse 89%, Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Vanilloid R-like 3/TRPV3 Antibody

  • transient receptor potential cation channel subfamily V member 3
  • transient receptor potential cation channel, subfamily V, member 3
  • TRPV3
  • vanilloid receptor 3
  • Vanilloid receptor-like 3
  • vanilloid receptor-related osmotically activated channel protein
  • Vanilloid R-like 3
  • VRL3
  • VRL-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1617
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-41262
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32096
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40763
Species: Hu, Mu, Rt, Gp, Ze
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12906
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, MiAr
NBP1-48036
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-98864
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
AF5708
Species: Hu
Applications: WB, ICC
NB100-98867
Species: Rt
Applications: WB, IHC
NBP2-57314
Species: Hu
Applications: ICC/IF

Publications for Vanilloid R-like 3/TRPV3 Antibody (NBP2-57314) (0)

There are no publications for Vanilloid R-like 3/TRPV3 Antibody (NBP2-57314).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vanilloid R-like 3/TRPV3 Antibody (NBP2-57314) (0)

There are no reviews for Vanilloid R-like 3/TRPV3 Antibody (NBP2-57314). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Vanilloid R-like 3/TRPV3 Antibody (NBP2-57314) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Vanilloid R-like 3/TRPV3 Products

Bioinformatics Tool for Vanilloid R-like 3/TRPV3 Antibody (NBP2-57314)

Discover related pathways, diseases and genes to Vanilloid R-like 3/TRPV3 Antibody (NBP2-57314). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Vanilloid R-like 3/TRPV3 Antibody (NBP2-57314)

Discover more about diseases related to Vanilloid R-like 3/TRPV3 Antibody (NBP2-57314).
 

Pathways for Vanilloid R-like 3/TRPV3 Antibody (NBP2-57314)

View related products by pathway.

PTMs for Vanilloid R-like 3/TRPV3 Antibody (NBP2-57314)

Learn more about PTMs related to Vanilloid R-like 3/TRPV3 Antibody (NBP2-57314).

Blogs on Vanilloid R-like 3/TRPV3

There are no specific blogs for Vanilloid R-like 3/TRPV3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Vanilloid R-like 3/TRPV3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPV3