UTP14A Antibody

Images

 
Western Blot: UTP14A Antibody [NBP1-56964] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UTP14A Antibody Summary

Immunogen
Synthetic peptides corresponding to UTP14A (UTP14, U3 small nucleolar ribonucleoprotein, homolog A (yeast)) The peptide sequence was selected from the N terminal of UTP14A. Peptide sequence KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UTP14A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against UTP14A and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UTP14A Antibody

  • Antigen NY-CO-16
  • dJ537K23.3
  • FLJ37089
  • NYCO16
  • NY-CO-16
  • SDCCAG16
  • Serologically defined colon cancer antigen 16KIAA0266
  • U3 small nucleolar RNA-associated protein 14 homolog A
  • UTP14, U3 small nucleolar ribonucleoprotein, homolog A (yeast)

Background

This gene encodes a member of the uridine triphosphate 14 family. As an essential component of a large ribonucleoprotein complex bound to the U3 small nucleolar RNA, the encoded protein is involved in ribosome biogenesis and 18S rRNA synthesis. An autosomal retrotransposed copy of this X-linked gene exists on chromosome 13. Alternative splicing results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002181-B01P
Species: Hu
Applications: WB, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-33483
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-49585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1007
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-92390
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86113
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83220
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-46383
Species: Hu
Applications: WB, Flow, IHC
NBP1-79778
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
H00051402-M01
Species: Hu
Applications: WB, ELISA
AF7068
Species: Hu
Applications: WB, IHC, ICC
NBP1-28745
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-56964
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB

Publications for UTP14A Antibody (NBP1-56964) (0)

There are no publications for UTP14A Antibody (NBP1-56964).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UTP14A Antibody (NBP1-56964) (0)

There are no reviews for UTP14A Antibody (NBP1-56964). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UTP14A Antibody (NBP1-56964) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UTP14A Products

Bioinformatics Tool for UTP14A Antibody (NBP1-56964)

Discover related pathways, diseases and genes to UTP14A Antibody (NBP1-56964). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UTP14A Antibody (NBP1-56964)

Discover more about diseases related to UTP14A Antibody (NBP1-56964).
 

Pathways for UTP14A Antibody (NBP1-56964)

View related products by pathway.

PTMs for UTP14A Antibody (NBP1-56964)

Learn more about PTMs related to UTP14A Antibody (NBP1-56964).

Blogs on UTP14A

There are no specific blogs for UTP14A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UTP14A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UTP14A
Uniprot