Signal sequence receptor delta Antibody - BSA Free

Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390] - Analysis in human pancreas and skeletal muscle tissues using NBP1-92390 antibody. Corresponding SSR4 RNA-seq data are presented for the same tissues.

Western Blot: Signal sequence receptor delta Antibody [NBP1-92390] - Analysis in human cell line AN3-CA.

Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Western Blot: Signal sequence receptor delta Antibody [NBP1-92390] - Analysis of human dermal fibroblasts at 1:500 dilution. Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390] - Staining of human kidney shows low expression as expected.

Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390] - Staining of human colon shows moderate to strong cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: Signal sequence receptor delta Antibody [NBP1-92390] - Staining of human kidney shows no positivity in cells in tubules as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Signal sequence receptor delta Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAA
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SSR4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 -1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Signal sequence receptor delta Protein (NBP1-92390PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Signal sequence receptor delta Antibody - BSA Free

• signal sequence receptor, delta (translocon-associated protein delta)
• SSR-delta
• translocon-associated protein delta
• translocon-associated protein subunit delta
• TRAP-delta
• TRAPDSignal sequence receptor subunit delta

Background

SSR4, also called TRAPD, is assumed to be involved in protein secretion. It is located in the Xq28 region, arranged in a compact head-to-head manner with the IDH3G gene. These two genes are driven by a bidirectional promoter located between them, and encode proteins involved in unrelated biochemical pathways located in different compartments of the cell. The nontranscribed intergenic region represents only 133 bp and is embedded in a CpG island. The CpG island functions as a bidirectional promoter to initiate the transcription of both functionally unrelated genes with distinct expression patterns. SSR4 consists of six exons and is approximately 70 kb telomeric to the ALD gene. Although alternative splicing of exon 5 has not been detected in human SSR4, transcript variants missing the region homologous to human exon 5 have been detected in both Xenopus laevis and Mus musculus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Signal sequence receptor delta Antibody (NBP1-92390)(1)

Publication using NBP1-92390

• Losfeld ME, Ng BG, Kircher M et al. A new congenital disorder of glycosylation caused by a mutation in SSR4, the signal sequence receptor 4 protein of the TRAP complex. Hum Mol Genet. 2013-11-13 [PMID: 24218363] (WB, Human)

Review for Signal sequence receptor delta Antibody (NBP1-92390) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Marie-estelle LOSFELD WB Human 02/27/2014

Summary

• Application: Western Blot
• Sample Tested: human dermal fibroblasts
• Species: Human
• Lot: R41490

Bioinformatics

• Gene Symbol: SSR4