USP20 Antibody (1A6) - Azide and BSA Free

Western Blot: USP20 Antibody (1A6) [H00010868-M01] - Detection against Immunogen (36.52 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1A6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

USP20 Antibody (1A6) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse USP20 Antibody (1A6) - Azide and BSA Free (H00010868-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: USP20 (NP_001008563, 252 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDAD
• Specificity: USP20 - ubiquitin specific protease 20
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: USP20
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP20 Antibody (1A6) - Azide and BSA Free

• Deubiquitinating enzyme 20
• EC 3.4.19.12
• KIAA1003hVDU2
• LSFR3A
• pVHL-interacting deubiquitinating enzyme 2
• ubiquitin carboxyl-terminal hydrolase 20
• ubiquitin specific peptidase 20
• ubiquitin specific protease 20
• ubiquitin thioesterase 20
• Ubiquitin Thiolesterase 20
• Ubiquitin-specific-processing protease 20
• USP20
• VDU2
• VHL-interacting deubiquitinating enzyme 2

Background

USP20 can specifically deubiquitinate and stabilize HIF-1alpha, increasing expression of HIF-1alpha targeted genes such as vascular endothelial growth factor (VEGF).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: USP20
• Entrez:
  • 10868(Human)
• Uniprot:
  • NP_001008563(Human)