USP14 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: USP14 Antibody [NBP1-86946] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: USP14 Antibody [NBP1-86946] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: USP14 Antibody [NBP1-86946] - Staining of human lymph node shows strong cytoplasmic and membranous positivity in germinal center cells.

Immunohistochemistry-Paraffin: USP14 Antibody [NBP1-86946] - Staining of human cerebral cortex shows moderate cytoplasmic and membranous positivity in neurons.

Analysis in human cell line U-251 MG.

Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

USP14 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit USP14 Antibody - BSA Free (NBP1-86946) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-USP14 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: USP14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 56 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  USP14 Recombinant Protein Antigen (NBP1-86946PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for USP14 Antibody - BSA Free

• Deubiquitinating enzyme 14
• EC 3.1.2.15
• EC 3.4.19.12
• TGT
• TGTubiquitin carboxyl-terminal hydrolase 14
• tRNA-guanine transglycosylase, 60-kD subunit
• ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
• ubiquitin specific protease 14 (tRNA-guanine transglycosylase)
• Ubiquitin Thioesterase 14
• Ubiquitin thiolesterase 14
• ubiquitin-specific processing protease 14
• Ubiquitin-specific-processing protease 14
• Ubp6
• USP14

Background

USP14 encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for USP14 Antibody (NBP1-86946)(1)

Publication using NBP1-86946

• Singh SJ, Tandon A, Phoolmala et al. Bisphenol-A (BPA) Impairs Hippocampal Neurogenesis via Inhibiting Regulation of the Ubiquitin Proteasomal System Molecular neurobiology 2023-02-25 [PMID: 36828952]

Bioinformatics

• Gene Symbol: USP14
• Entrez:
  • 9097(Human)
• Uniprot:
  • P54578()