USF2 Antibody (5F2)

Images

 
Western Blot: USF2 Antibody (5F2) [H00007392-M02] - USF2 monoclonal antibody (M02), clone 5F2. Analysis of USF2 expression in different cell lines.
Immunocytochemistry/ Immunofluorescence: USF2 Antibody (5F2) [H00007392-M02] - Analysis of monoclonal antibody to USF2 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: USF2 Antibody (5F2) [H00007392-M02] - Analysis of monoclonal antibody to USF2 on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 1 ug/ml.
Western Blot: USF2 Antibody (5F2) [H00007392-M02] - USF2 monoclonal antibody (M02), clone 5F2. Analysis of USF2 expression in PC-12.
Sandwich ELISA: USF2 Antibody (5F2) [H00007392-M02] - Detection limit for recombinant GST tagged USF2 is approximately 10ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
5F2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

USF2 Antibody (5F2) Summary

Immunogen
USF2 (NP_003358, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVS
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
USF2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USF2 Antibody (5F2)

  • BHLHB12
  • bHLHb12upstream stimulatory factor 2
  • Class B basic helix-loop-helix protein 12
  • FIPc-fos interacting protein
  • FOS-interacting protein
  • Major late transcription factor 2
  • Upstream transcription factor 2
  • upstream transcription factor 2, c-fos interacting

Background

This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB600-232
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00007392-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for USF2 Antibody (H00007392-M02) (0)

There are no publications for USF2 Antibody (H00007392-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USF2 Antibody (H00007392-M02) (0)

There are no reviews for USF2 Antibody (H00007392-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USF2 Antibody (H00007392-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USF2 Products

Bioinformatics Tool for USF2 Antibody (H00007392-M02)

Discover related pathways, diseases and genes to USF2 Antibody (H00007392-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USF2 Antibody (H00007392-M02)

Discover more about diseases related to USF2 Antibody (H00007392-M02).
 

Pathways for USF2 Antibody (H00007392-M02)

View related products by pathway.

PTMs for USF2 Antibody (H00007392-M02)

Learn more about PTMs related to USF2 Antibody (H00007392-M02).

Blogs on USF2

There are no specific blogs for USF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USF2 Antibody (5F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol USF2
Entrez
OMIM
Uniprot