Home » UQCRC1 » UQCRC1 Antibodies » UQCRC1 Antibody

UQCRC1 Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: UQCRC1 Antibody [NBP1-85329] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Western Blot: UQCRC1 Antibody [NBP1-85329] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Orthogonal Strategies: Immunohistochemistry-Paraffin: UQCRC1 Antibody [NBP1-85329] - Staining in human heart muscle and lymph node tissues using anti-UQCRC1 antibody. Corresponding UQCRC1 RNA-seq data are ...read more
Western Blot: UQCRC1 Antibody [NBP1-85329] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: UQCRC1 Antibody [NBP1-85329] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: UQCRC1 Antibody [NBP1-85329] - Staining of human lymph node shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

UQCRC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGG
Specificity
Specificity of human, mouse, rat UQCRC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UQCRC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UQCRC1 Protein (NBP1-85329PEP)
Publications
Read Publications using
NBP1-85329 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23965338).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UQCRC1 Antibody

  • Complex III subunit 1
  • Core protein I
  • cytochrome b-c1 complex subunit 1, mitochondrial
  • D3S3191
  • QCR1
  • ubiquinol-cytochrome c reductase core protein I
  • Ubiquinol-cytochrome-c reductase complex core protein 1
  • UQCR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

UQCRC2 Antibody
NBP1-80861
Western Blot: UQCRC2 Antibody [NBP1-80861] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: UQCRC2 Antibody [NBP1-80861] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80861] - Staining in human heart muscle and pancreas tissues using anti-UQCRC2 antibody. Corresponding UQCRC2 RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
GNB2 Antibody
NBP2-16700
Western Blot: GNB2 Antibody [NBP2-16700] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 10% SDS PAGE gel, diluted at 1:10000.
Western Blot: GNB2 Antibody [NBP2-16700] - Sample (30 ug of whole cell lysate) A: A431 10% SDS PAGE gel, diluted at 1:1000.
Species: Hu, Mu
Applications: WB
Pepsinogen
C/PGC/Progastricsin A
NBP1-91012
Western Blot: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91012] - Staining in human stomach and skeletal muscle tissues using anti-PGC antibody. Corresponding PGC RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ECHS1 Antibody
NBP1-87078
Western Blot: ECHS1 Antibody [NBP1-87078] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: ECHS1 Antibody [NBP1-87078] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP1-87078] - Staining of human skeletal muscle shows low expression as expected.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Cytosolic
Sulfotransferase 1A1/ ...
NBP2-03227
Western Blot: SULT1A1 Antibody (9B7) [NBP2-03227] Analysis of extracts (35ug) from 9 different cell lines by using anti-SULT1A1 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: SULT1A1 Antibody (9B7) [NBP2-03227] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY SULT1A1.
Immunohistochemistry-Paraffin: SULT1A1 Antibody (9B7) [NBP2-03227] - Staining of paraffin-embedded Human prostate tissue using anti-SULT1A1 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
UCH-L1/PGP9.5
Antibody (31A3)
NB600-1160
Western Blot: UCH-L1/PGP9.5 Antibody (31A3) [NB600-1160] - analysis of UchL1 in 1) human, 2) mouse and 3) rat brain lysate using UchL1 antibody at 1 ug/ml. goat anti-mouse Ig HRP secondary antibody and ECL substrate solution were used for this test.
Immunocytochemistry/Immunofluorescence: UCH-L1/PGP9.5 Antibody (31A3) [NB600-1160] - analysis of PGP9.5 in rat mesenteric artery using anti-PGP9.5 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody (31A3) [NB600-1160] - Formalin-fixed, paraffin-embedded human brain stained with UchL1 antibody (PGP9.5) (1:500), peroxidase-conjugate and DAB chromogen. Staining seen in cytoplasm, ER and membrane. Fixation in 95% ethanol/5% acetic acid for 2-3 hours prior to paraffin embedding is recommended. Specimens which have not been fixed in acetic acid/alcohol require pre-treatment with citrate buffer: for example, unmask of the target epitope by boiling the tissue sections in 10mM citrate buffer, pH 6.0, for 10 min followed by cooling at room temp for 20 min.
(1 Review)
(8 Publications)
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Lamin A + C
Antibody (4C4)
NBP2-25151
Western Blot: Lamin A + C Antibody (4C4) [NBP2-25151] - Analysis of different cell lysates using mouse mAb to lamin A/C, NBP2-25151, dilution 1:1,000 in green: [1] protein standard (red), [2] HeLa, [3] HEK293 [4] C6, and [5] NIH-3T3 cell lysates. Two strong bands at 74 and 65kDa correspond to the lamin A and lamin C proteins respectively, detected only in the cells of human origin. NBP2-25151 antibody failed to recognize rat or mouse proteins.
Immunocytochemistry/Immunofluorescence: Lamin A + C Antibody (4C4) [NBP2-25151] - Analysis of HeLa cells stained with mouse mAb to lamin A/C, NBP2-25151, dilution 1:2,000 in red, and costained with rabbit pAb to HSP60, dilution 1:5,000, in green. The blue is Hoechst staining of nuclear DNA. NBP2-25151 antibody specifically labels the nuclear lamina, while the HSP60 antibody reveals protein expressed in mitochondria.
Immunocytochemistry/Immunofluorescence: Lamin A + C Antibody (4C4) [NBP2-25151] - HeLa cells staing with NBP2-25151 (red), and counterstained with chicken polyclonal antibody to Vimentin NB300-223 (green) and DNA (blue). NBP2-25151 reveals strong nuclear lamina staining, while the Vimentin antibody reveals cytoplasmic intermediate filaments.
Species: Hu
Applications: WB, ICC/IF, IHC

GRP75/HSPA9B/Mortalin
NBP1-47801
Western Blot: GRP75/HSPA9B/Mortalin Antibody (9F8) [NBP1-47801] - Analysis of extracts from 9 different cell lines: (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunocytochemistry/Immunofluorescence: GRP75/HSPA9B/Mortalin Antibody (9F8) [NBP1-47801] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY GRP75/HSPA9B/Mortalin.
Immunohistochemistry-Paraffin: GRP75/HSPA9B/Mortalin Antibody (9F8) [NBP1-47801] - Staining of paraffin-embedded Human pancreas tissue using anti-GRP75/HSPA9B/Mortalin mouse monoclonal antibody.
(1 Publication)
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
OAT Antibody
NBP1-83239
Western Blot: OAT Antibody [NBP1-83239] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
IMP Dehydrogenase
2/IMPDH2 Antibody
NBP1-86177
Western Blot: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1, using Anti-IMPDH2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB
Immunocytochemistry/Immunofluorescence: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Staining of human cell line A-431 shows localization to cytosol & rods & rings.
Immunohistochemistry-Paraffin: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Staining of human breast shows moderate cytoplasmic and nuclear positivity in glandular cells.
(4 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - analysis of HeLa cell culture stained with chicken pAb to vimentin, NB300-223, dilution 1:10,000 in green, and costained with EnCor mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Vimentin Antibody [NB300-223] - Analysis of tissue and cell lysates using chicken pAb to Vimentin, NB300-223, dilution 1:5,000 in red. [1] protein standard (red), [2] rat whole brain lysate, [3] HeLa, [4] SH-SY5Y, [5] HEK293, and [6] NIH-3T3 cell lysates. NB300-223 binds to the vimentin protein showing a single band at ~50 kDa. The blot was simultaneously probed with mouse mAb to MAP2C/D, dilution 1:5,000 in green, revealing multiple bands around 280kDa that correspond to full length MAP2A/2B isotypes, and ~70kDa bands which are MAP2C/D isotypes. MAP2 isotypes are seen only in extracts containing neuronal lineage cells.
(1 Review)
(22 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Cytochrome c
Antibody (7H8.2C12)
NB100-56503
Western Blot: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Analysis using the Biotin conjugate of NB100-56503. Detection of Cytochrome C in 15 mgs of HeLa cell lysate using NB100-55775 at 1:1000. A 15 kDa band is detected.
Immunocytochemistry/Immunofluorescence: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - p73 was detected in immersion fixed Hela human cell line using Cytochrome C [7H8.2C12] Monoclonal Antibody (Catalog # NB100-56503) at 25 ug/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Staining was observed in the cytoplasm and mitochondria.
Immunohistochemistry-Paraffin: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Cytochrome C was detected in immersion fixed paraffin-embedded sections of human heart using anti-human mouse monoclonal antibody (Catalog # NB100-56503) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(47 Publications)
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
RTN4IP1 Antibody
(OTI3B2)
NBP2-00478
Western Blot: RTN4IP1 Antibody (3B2) [NBP2-00478] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RTN4IP1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RTN4IP1.
Immunohistochemistry-Paraffin: RTN4IP1 Antibody (3B2) [NBP2-00478] Staining of paraffin-embedded Human pancreas tissue using anti-RTN4IP1 mouse monoclonal antibody.
Flow Cytometry: RTN4IP1 Antibody (3B2) [NBP2-00478] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-RTN4IP1 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
HSP60 Antibody
NBP1-77397
Western Blot: HSP60 Antibody [NBP1-77397] - Western blot analysis of extracts from HeLa and COS cells using NBP1-77397 Hsp60 antibody at 1:1000
Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-77397] - Confocal immunofluorescent analysis of HeLa cells using Hsp60 antibody (NBP1-77397, 1:100). An Alexa Fluor 488-conjugated Goat to rabbit IgG was used as secondary antibody (green, A). Actin filaments were labeled with Alexa Fluor 568 phalloidin (red, B). DAPI was used to stain the cell nuclei (blue, C).
Immunohistochemistry: HSP60 Antibody [NBP1-77397] - IHC staining of HSP60 in human kidney carcinoma using DAB with hematoxylin counterstain.
(4 Reviews)
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Rhodopsin Antibody
(A531)
NBP2-25159
Western Blot: Rhodopsin Antibody (A531) [NBP2-25159] - Blot of bovine retinal extracts. The antibody stains a band corresponing to retinal Rhodopsin at about 35kDa. Bands about 70 kDa and 140 kDa are aggregated forms of Rhodopsin. Note, due to the highly hydrophobic nature of Rhodopsin, it is important not to boil a sample containing it in SDS-PAGE sample buffer, as this will result in more extensive aggregation of the Rhodopsin protein.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (A531) [NBP2-25159] - Pig retinal section stained with NBP2-25159 (green) and counterstained with rabbit polyclonal antibody to NF-M NB300-133 (red) and DNA (blue). Rhodopsin is most abundant in the outer segments of retina (OS), NF-M is abundant in the optic nerve fiber layer (ONFL), but seen in processes and neurons in other regions also. Other layers are pigmented epithelium (PE), outer and inner nuclear layers (ONL, INL), outer and inner plexiform layers (OPL, IPL) and ganglion cell layer (GCL).
(1 Publication)
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis in human cell lines A-549 and U-251MG using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining in human adrenal gland and pancreas tissues using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ACAT2 Antibody
(OTI3E2)
NBP2-02588
Western Blot: ACAT2 Antibody (3E2) [NBP2-02588] Analysis of extracts (35ug) from 9 different cell lines by using anti-ACAT2 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: ACAT2 Antibody (3E2) [NBP2-02588] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY ACAT2.
Immunohistochemistry-Paraffin: ACAT2 Antibody (3E2) [NBP2-02588] - Staining of paraffin-embedded Human prostate tissue using anti-ACAT2 mouse monoclonal antibody.
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
TIMP-3
[Unconjugated]
973-TM
TIMP-3 [Unconjugated]
(1 Review)
(14 Publications)
Species: Hu
UQCRC1 Antibody
NBP1-85329
UQCRC1 Antibody
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for UQCRC1 Antibody (NBP1-85329)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for UQCRC1 Antibody (NBP1-85329) (0)

There are no reviews for UQCRC1 Antibody (NBP1-85329). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UQCRC1 Antibody (NBP1-85329) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UQCRC1 Products

Bioinformatics Tool for UQCRC1 Antibody (NBP1-85329)

Discover related pathways, diseases and genes to UQCRC1 Antibody (NBP1-85329). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UQCRC1 Antibody (NBP1-85329)

Discover more about diseases related to UQCRC1 Antibody (NBP1-85329).
 

Pathways for UQCRC1 Antibody (NBP1-85329)

View related products by pathway.

PTMs for UQCRC1 Antibody (NBP1-85329)

Learn more about PTMs related to UQCRC1 Antibody (NBP1-85329).

Blogs on UQCRC1

There are no specific blogs for UQCRC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UQCRC1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol UQCRC1