Home » UQCRC1 » UQCRC1 Research Products » UQCRC1 Antibody

UQCRC1 Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: UQCRC1 Antibody [NBP1-85329] - Analysis using Anti-UQCRC1 antibody NBP1-85329 (A) shows similar pattern to independent antibody NBP1-85328 (B).
Independent Antibodies: Western Blot: UQCRC1 Antibody [NBP1-85329] - Analysis using Anti-UQCRC1 antibody NBP1-85329 (A) shows similar pattern to independent antibody NBP1-85328 (B).
Orthogonal Strategies: Immunohistochemistry-Paraffin: UQCRC1 Antibody [NBP1-85329] - Staining in human heart muscle and lymph node tissues using anti-UQCRC1 antibody. Corresponding UQCRC1 RNA-seq data are ...read more
Western Blot: UQCRC1 Antibody [NBP1-85329] - Analysis in human cell line HEK 293.
Western Blot: UQCRC1 Antibody [NBP1-85329] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: UQCRC1 Antibody [NBP1-85329] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: UQCRC1 Antibody [NBP1-85329] - Staining of human lymph node shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

UQCRC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UQCRC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 25605331). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UQCRC1 Protein (NBP1-85329PEP)
Publications
Read Publications using
NBP1-85329 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23965338).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UQCRC1 Antibody

  • Complex III subunit 1
  • Core protein I
  • cytochrome b-c1 complex subunit 1, mitochondrial
  • D3S3191
  • QCR1
  • ubiquinol-cytochrome c reductase core protein I
  • Ubiquinol-cytochrome-c reductase complex core protein 1
  • UQCR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

UQCRC2 Antibody
NBP1-80861
Immunocytochemistry/Immunofluorescence: UQCRC2 Antibody [NBP1-80861] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80861] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: UQCRC2 Antibody [NBP1-80861] - Staining of human pancreas shows low expression as expected.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GNB2 Antibody
(JE47-16)
NBP2-80432
Western Blot: GNB2 Antibody (JE47-16) [NBP2-80432] - Western blot analysis of GNB2 on MCF-7 cell lysate. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1:500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.
Immunohistochemistry-Paraffin: GNB2 Antibody (JE47-16) [NBP2-80432] - Immunohistochemical analysis of paraffin-embedded rat kidney tissue using anti-GNB2 antibody. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:200) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Immunohistochemistry-Paraffin: GNB2 Antibody (JE47-16) [NBP2-80432] - Immunohistochemical analysis of paraffin-embedded mouse brain tissue using anti-GNB2 antibody. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:200) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Pepsinogen
C/PGC/Progastricsin A
NBP1-91011
Western Blot: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Analysis in human stomach tissue.
Western Blot: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Analysis in control (vector only transfected HEK293T lysate) and PGC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Staining of human cerebral cortex, colon, skeletal muscle and stomach using Anti-PGC antibody NBP1-91011 (A) shows similar protein distribution across tissues to independent antibody NBP1-91012 (B).
(1 Publication)
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
ECHS1 Antibody
NBP2-16263
Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP2-16263] - ECHS1 antibody detects ECHS1 protein at mitochondria on mouse heart by immunohistochemical analysis. Sample: Paraffin-embedded mouse heart. ECHS1 antibody dilution: 1:500.
Western Blot: ECHS1 Antibody [NBP2-16263] - ECHS1 antibody detects ECHS1 protein by western blot analysis. Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with ECHS1 antibody diluted by 1:5000.
Immunohistochemistry-Paraffin: ECHS1 Antibody [NBP2-16263] - ECHS1 antibody detects ECHS1 protein at mitochondria on mouse heart by immunohistochemical analysis. Sample: Paraffin-embedded mouse heart. ECHS1 antibody dilution: 1:500.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Cytosolic
Sulfotransferase 1A1/ ...
NBP2-03227
Flow Cytometry: SULT1A1 Antibody (9B7) [NBP2-03227] - Analysis of Jurkat cells, using anti-SULT1A1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: SULT1A1 Antibody (9B7) [NBP2-03227] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-SULT1A1 antibody, and then analyzed by flow cytometry.
Western Blot: SULT1A1 Antibody (9B7) [NBP2-03227] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SULT1A1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SULT1A1.
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
UCH-L1/PGP9.5
Antibody (31A3)
NB600-1160
Flow Cytometry: UCH-L1/PGP9.5 Antibody (31A3) [NB600-1160] - Flow Cytometric Analysis of T98G cells using UCH-L1/PGP9.5 Antibody (31A3)followed by Goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
Immunocytochemistry/Immunofluorescence: UCH-L1/PGP9.5 Antibody (31A3) [NB600-1160] - Immunofluorescence Analysis of T98G cells labeling Pgp9.5 with UCH-L1/PGP9.5 Antibody (31A3) followed by Goat anti-Mouse IgG-CF488 (Green). The nuclear counterstain is Nucspot (Red)
Western Blot: UCH-L1/PGP9.5 Antibody (31A3) [NB600-1160] - Western Blot Analysis of human brain tissue lysate using UCH-L1/PGP9.5 Antibody (31A3)
(14 Publications)
Species: Bv, Hu, Mu, Po, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Lamin A + C
Antibody (4C4)
NBP2-25151
Immunocytochemistry/Immunofluorescence: Lamin A + C Antibody (4C4) [NBP2-25151] - Analysis of HeLa cells stained with mouse mAb to lamin A/C, NBP2-25151, dilution 1:2,000 in red, and costained with rabbit pAb to HSP60, dilution 1:5,000, in green. The blue is Hoechst staining of nuclear DNA. NBP2-25151 antibody specifically labels the nuclear lamina, while the HSP60 antibody reveals protein expressed in mitochondria.
Western Blot: Lamin A + C Antibody (4C4) [NBP2-25151] - Analysis of different cell lysates using mouse mAb to lamin A/C, NBP2-25151, dilution 1:1,000 in green: [1] protein standard (red), [2] HeLa, [3] HEK293 [4] C6, and [5] NIH-3T3 cell lysates. Two strong bands at 74 and 65kDa correspond to the lamin A and lamin C proteins respectively, detected only in the cells of human origin. NBP2-25151 antibody failed to recognize rat or mouse proteins.
Immunocytochemistry/Immunofluorescence: Lamin A + C Antibody (4C4) [NBP2-25151] - HeLa cells staing with NBP2-25151 (red), and counterstained with chicken polyclonal antibody to Vimentin NB300-223 (green) and DNA (blue). NBP2-25151 reveals strong nuclear lamina staining, while the Vimentin antibody reveals cytoplasmic intermediate filaments.
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, WB

GRP75/HSPA9B/Mortalin
NBP1-47801
Flow Cytometry: GRP75/HSPA9B/Mortalin Antibody (9F8) [NBP1-47801] - Analysis of Hela cells, using anti-Mortalin antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: GRP75/HSPA9B/Mortalin Antibody (9F8) [NBP1-47801] - Analysis of Jurkat cells, using anti-Mortalin antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Immunocytochemistry/Immunofluorescence: GRP75/HSPA9B/Mortalin Antibody (9F8) [NBP1-47801] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY GRP75/HSPA9B/Mortalin.
(1 Publication)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
OAT Antibody
NBP1-83239
Western Blot: OAT Antibody [NBP1-83239] - Analysis in control (vector only transfected HEK293T lysate) and OAT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Analysis in human duodenum and pancreas tissues. Corresponding OAT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neurons.
Species: Bv, Hu
Applications: IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(14 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
IMP Dehydrogenase
2/IMPDH2 Antibody (JE ...
NBP2-75541
Flow Cytometry: IMP Dehydrogenase 2/IMPDH2 Antibody (JE40-87) [NBP2-75541] - Analysis of Daudi cells with IMPDH2 antibody at 1/100 dilution (purple) compared with an unlabelled control (cells without incubation with primary antibody; yellow). Alexa Fluor 488-conjugated goat anti-rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: IMP Dehydrogenase 2/IMPDH2 Antibody (JE40-87) [NBP2-75541] - Staining IMPDH2 in A431 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: IMP Dehydrogenase 2/IMPDH2 Antibody (JE40-87) [NBP2-75541] - Staining IMPDH2 in LOVO cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Immunohistochemistry-Frozen: Vimentin Antibody [NB300-223] - 10 um Cryosections from PFA fixed murine brain acute slices stained with Vimentin antibody (1:600) and Alexa Fluor 488 anti chicken IgG. Antibody showed specific staining, also of blood vessels. IHC-Fr image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Human A7 cells. Cells were fixed with 10% formalin and permeabilized with 0.1% TritonX-100. After blocking, cells were incubated with primary antibody (1:600) at 4C O/N followed with Alexa Fluor 488 labeled secondary antibody and counterstained with DAPI and Phalloidin for nuclei and F-actin respectively. Imaged with Leica TCS SP5 confocal microscope. ICC/IF image submitted by a verified customer review.
(54 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Using the Alexa Fluor 488 direct conjugate, an intracellular stain was performed on HeLa cells with Cytochrome c (7H8.2C12) antibody NB100-56503AF488 (blue) and a matched isotype control NBP2-27231AF488 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): Cytochrome c Antibody (7H8.2C12) [NB100-56503] - An intracellular stain was performed on HeLa cells with Cytochrome c (7H8.2C12) antibody NB100-56503PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to phycoerythrin.
Western Blot: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Metformin activates apoptotic cell death; Right panel: MCF-7 cells were kept in the presence or absence of metformin for 20 days and then processed to obtain mitochondrial or whole cellular extracts. BAX and CYCS expression levels were determined by Western blot as indicated under Material and Methods. Densitometric analysis of the gels was performed as indicated under Material and Methods. PHB and CDK4 were used as purity and loading controls. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/2073-4409/8/1/49), licensed under a CC-BY licence.
(58 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
RTN4IP1 Antibody
(OTI3B2)
NBP2-00478
Flow Cytometry: RTN4IP1 Antibody (3B2) [NBP2-00478] - Analysis of Jurkat cells, using anti-RTN4IP1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: RTN4IP1 Antibody (3B2) [NBP2-00478] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-RTN4IP1 antibody, and then analyzed by flow cytometry.
Western Blot: RTN4IP1 Antibody (3B2) [NBP2-00478] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RTN4IP1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RTN4IP1.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
HSP60 Antibody -
BSA Free
NBP1-77397
Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-77397] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody (NBP1-77397) at 1 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-77397] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody conjugated to Alexa Fluor 488 (NBP1-77397AF488) at 5 ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Simple Western: HSP60 Antibody [NBP1-77397] - Lane view shows a specific band for Hsp60 in 0.05 mg/ml of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(3 Publications)
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Rhodopsin Antibody
(B630)
NBP2-25160
Immunohistochemistry: Rhodopsin Antibody (B630) [NBP2-25160] - Rhodopsin expression and the prevalence of rod photoreceptors in the canine retina. (A) Fluorescence micrographs showing rhodopsin expression (red) in the ABCA4+/+ (left), ABCA4+/- (middle), and ABCA4-/- (right) rod outer segments. Scale bar = 10 um. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.
Western Blot: Rhodopsin Antibody (B630) [NBP2-25160] - Western blot analyses of ABCA4 (above), GAPDH (middle), and RHO (below) protein levels in retinal tissue of dogs with the three different genotypes. Image collected and cropped by CiteAb from the following publication. 50 ug of protein samples were resolved by SDS-PAGE, transferred to nitrocellulose membrane, and immunoblotted with the following primary antibodies: ABCA4 (NBP1-30032, 1:1000) and Rhodopsin (NBP2-25160, 1:5000), followed by Anti-Mouse IgG horseradish peroxidase-conjugated secondary antibody (R&D Systems, HAF007, 1:5000. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (B630) [NBP2-25160] - High magnification confocal image of pig retinal section stained with NBP2-25160 (Green). Rhodopsin is most abundant in the rod outer segments (ROS) of retina, clearly localized in rod membranes. The rod inner segments (RIS) and rod nuclei in the outer nuclear layer (ONL) are also seen in this image. Nuclear DNA was stained with DAPI (blue).
(4 Publications)
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis in human cell lines A-549 and U-251MG using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis using Anti-FDXR antibody NBP2-38530 (A) shows similar pattern to independent antibody NBP2-38706 (B).
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ACAT2 Antibody
(OTI3E2)
NBP2-02588
Flow Cytometry: ACAT2 Antibody (3E2) [NBP2-02588] - Analysis of Jurkat cells, using anti-ACAT2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: ACAT2 Antibody (3E2) [NBP2-02588] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-ACAT2 antibody, and then analyzed by flow cytometry.
Western Blot: ACAT2 Antibody (3E2) [NBP2-02588] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ACAT2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-ACAT2.
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TIMP-3
[Unconjugated]
973-TM
TIMP-3 [Unconjugated]
(2 Reviews)
(21 Publications)
Species: Hu
Applications: InhibAct
UQCRC1 Antibody
NBP1-85329
UQCRC1 Antibody
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for UQCRC1 Antibody (NBP1-85329)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for UQCRC1 Antibody (NBP1-85329) (0)

There are no reviews for UQCRC1 Antibody (NBP1-85329). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UQCRC1 Antibody (NBP1-85329) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UQCRC1 Products

Bioinformatics Tool for UQCRC1 Antibody (NBP1-85329)

Discover related pathways, diseases and genes to UQCRC1 Antibody (NBP1-85329). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UQCRC1 Antibody (NBP1-85329)

Discover more about diseases related to UQCRC1 Antibody (NBP1-85329).
 

Pathways for UQCRC1 Antibody (NBP1-85329)

View related products by pathway.

PTMs for UQCRC1 Antibody (NBP1-85329)

Learn more about PTMs related to UQCRC1 Antibody (NBP1-85329).

Blogs on UQCRC1

There are no specific blogs for UQCRC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UQCRC1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol UQCRC1