UPF3A Antibody

Images

 
Immunohistochemistry-Paraffin: UPF3A Antibody [NBP1-83136] - Staining of human testis shows strong cytoplasmic and nuclear positivity in developing spermatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UPF3A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KARPMEGSLEEPQETSHSGSDKEHRDVERSQEQESEAQRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UPF3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UPF3A Protein (NBP1-83136PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UPF3A Antibody

  • HUPF3A
  • Nonsense mRNA reducing factor 3A
  • regulator of nonsense transcripts 3A
  • RENT3AUp-frameshift suppressor 3 homolog A
  • UPF3 regulator of nonsense transcripts homolog A (yeast)
  • UPF3hUpf3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-368
Species: Hu
Applications: WB
NBP2-20813
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-83134
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58599
Species: Hu
Applications: ICC/IF
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-33598
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
NBP1-30321
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NBP2-57560
Species: Hu
Applications: ICC/IF
H00055110-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-46689
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85268
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-92410
Species: Hu
Applications: WB (-), ICC/IF, IHC, IHC-P

Publications for UPF3A Antibody (NBP1-83136) (0)

There are no publications for UPF3A Antibody (NBP1-83136).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UPF3A Antibody (NBP1-83136) (0)

There are no reviews for UPF3A Antibody (NBP1-83136). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for UPF3A Antibody (NBP1-83136) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UPF3A Products

Bioinformatics Tool for UPF3A Antibody (NBP1-83136)

Discover related pathways, diseases and genes to UPF3A Antibody (NBP1-83136). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UPF3A Antibody (NBP1-83136)

Discover more about diseases related to UPF3A Antibody (NBP1-83136).
 

Pathways for UPF3A Antibody (NBP1-83136)

View related products by pathway.

PTMs for UPF3A Antibody (NBP1-83136)

Learn more about PTMs related to UPF3A Antibody (NBP1-83136).

Blogs on UPF3A

There are no specific blogs for UPF3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UPF3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UPF3A