UPF3B Antibody - BSA Free

Immunohistochemistry-Paraffin: UPF3B Antibody [NBP1-83134] - Staining in human testis and liver tissues using NBP1-83134 antibody. Corresponding UPF3B RNA-seq data are presented for the same tissues.

Western Blot: UPF3B Antibody [NBP1-83134] - Analysis using Anti-UPF3B antibody NBP1-83134 (A) shows similar pattern to independent antibody NBP2-55617 (B).

Immunocytochemistry/Immunofluorescence: UPF3B Antibody [NBP1-83134] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: UPF3B Antibody [NBP1-83134] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: UPF3B Antibody [NBP1-83134] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: UPF3B Antibody [NBP1-83134] - Staining of human lymphoid tissues shows moderate cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: UPF3B Antibody [NBP1-83134] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UPF3B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UPF3B Antibody - BSA Free (NBP1-83134) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEALSKVVIRRLPPTLTKEQLQEHLQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYVFLDNKGQEYPAIVE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UPF3B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  UPF3B Protein (NBP1-83134PEP)

Reactivity Notes

Mouse (86%), Rat (87%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UPF3B Antibody - BSA Free

• HUPF3B
• Nonsense mRNA reducing factor 3B
• regulator of nonsense transcripts 3B
• RENT3BhUpf3p-X
• UPF3 regulator of nonsense transcripts homolog B (yeast)
• UPF3XMRXS14
• Up-frameshift suppressor 3 homolog B
• Up-frameshift suppressor 3 homolog on chromosome X

Background

The UPF3B gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear exportand mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detectsexported mRNAs with

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UPF3B