UPF3B Antibody

Images

 
Western Blot: UPF3B Antibody [NBP1-83134] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: UPF3B Antibody [NBP1-83134] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: UPF3B Antibody [NBP1-83134] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic and decidua cells.
Western Blot: UPF3B Antibody [NBP1-83134] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UPF3B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEALSKVVIRRLPPTLTKEQLQEHLQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYVFLDNKGQEYPAIVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UPF3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UPF3B Protein (NBP1-83134PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UPF3B Antibody

  • HUPF3B
  • Nonsense mRNA reducing factor 3B
  • regulator of nonsense transcripts 3B
  • RENT3BhUpf3p-X
  • UPF3 regulator of nonsense transcripts homolog B (yeast)
  • UPF3XMRXS14
  • Up-frameshift suppressor 3 homolog B
  • Up-frameshift suppressor 3 homolog on chromosome X

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20813
Species: Hu, Mu
Applications: WB, ICC/IF
H00065110-M06
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-368
Species: Hu
Applications: WB
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00055110-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-46689
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85268
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58599
Species: Hu
Applications: ICC/IF
NBP1-33598
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-30321
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33202
Species: Hu, Mu
Applications: WB, IP
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-33404
Species: Hu
Applications: IHC, IHC-P

Publications for UPF3B Antibody (NBP1-83134) (0)

There are no publications for UPF3B Antibody (NBP1-83134).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UPF3B Antibody (NBP1-83134) (0)

There are no reviews for UPF3B Antibody (NBP1-83134). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UPF3B Antibody (NBP1-83134) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UPF3B Products

Bioinformatics Tool for UPF3B Antibody (NBP1-83134)

Discover related pathways, diseases and genes to UPF3B Antibody (NBP1-83134). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UPF3B Antibody (NBP1-83134)

Discover more about diseases related to UPF3B Antibody (NBP1-83134).
 

Pathways for UPF3B Antibody (NBP1-83134)

View related products by pathway.

PTMs for UPF3B Antibody (NBP1-83134)

Learn more about PTMs related to UPF3B Antibody (NBP1-83134).

Blogs on UPF3B

There are no specific blogs for UPF3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UPF3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UPF3B