UNC45B Antibody - BSA Free

Western Blot: UNC45B Antibody [NBP2-88557] - Host: Rabbit. Target Name: UNC45B. Sample Type: 721_B whole cell lysates. Antibody Dilution: 1.0ug/ml

Western Blot: UNC45B Antibody [NBP2-88557] - Host: Rabbit. Target: UNC45B. Positive control (+): Mouse Heart (M-HE). Negative control (-): Mouse Kidney (M-KI). Antibody concentration: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

UNC45B Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human UNC45B. Peptide sequence: TLVNCTNSYDVKEVIPELVQLAKFSKQHVPEEHPKDKKDFIDMRVKRLLK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UNC45B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for UNC45B Antibody - BSA Free

• CMYA4
• FLJ38610
• MGC119540
• MGC119541
• protein unc-45 homolog B
• SMUNC45
• striated muscle UNC45
• unc-45 homolog B (C. elegans)
• UNC-45B
• UNC45cardiomyopathy associated 4

Background

UNC45B plays a role in myoblast fusion and sarcomere organization (Price et al., 2002 [PubMed 12356907]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UNC45B