UNC13D/Munc 13-4 Recombinant Protein Antigen

Images

 
There are currently no images for UNC13D/Munc 13-4 Recombinant Protein Antigen (NBP2-57967PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

UNC13D/Munc 13-4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UNC13D/Munc 13-4.

Source: E. coli

Amino Acid Sequence: TEWFHLKQQHHQPMVQGIPEAGKALLGLVQDVIGDLHQCQRTWDKIFHNTLKIHLFSMAFRELQWLVAKRVQDHTTVVGDVV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UNC13D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57967.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UNC13D/Munc 13-4 Recombinant Protein Antigen

  • FHL3
  • HLH3
  • HPLH3
  • Munc13-4
  • Munc13-4protein unc-13 homolog D
  • unc-13 homolog D (C. elegans)
  • UNC13D

Background

Munc 13-4 encodes a protein that is a member of the UNC13 family, containing similar domain structure as other family members but lacking an N-terminal phorbol ester-binding C1 domain present in other Munc13 proteins. The protein appears to play a role in vesicle maturation during exocytosis and is involved in regulation of cytolytic granules secretion. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis type 3, a genetically heterogeneous, rare autosomal recessive disorder.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86122
Species: Hu
Applications: IHC,  IHC-P, WB
H00005873-M02
Species: Hu, Mu, Rb
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, S-ELISA, WB
NBP3-17459
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF5900
Species: Hu
Applications: WB
NBP1-84978
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33037
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32660
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-19294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00001130-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB5938
Species: Hu
Applications: ICC, WB
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-84764
Species: Hu
Applications: IHC,  IHC-P
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-57967PEP
Species: Hu
Applications: AC

Publications for UNC13D/Munc 13-4 Recombinant Protein Antigen (NBP2-57967PEP) (0)

There are no publications for UNC13D/Munc 13-4 Recombinant Protein Antigen (NBP2-57967PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UNC13D/Munc 13-4 Recombinant Protein Antigen (NBP2-57967PEP) (0)

There are no reviews for UNC13D/Munc 13-4 Recombinant Protein Antigen (NBP2-57967PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for UNC13D/Munc 13-4 Recombinant Protein Antigen (NBP2-57967PEP). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking Munc13-4 N terminal antibody with related epitope sequence.
    • Unfortunately we do not epitope map our antibodies, but we do have a whole list of antibodies against your target depending on species reactivity and application you want to use them for. Please see this link to our MUNC 13-4 antibodies. All of the immunogen information that is not proprietary, or known should be presented on the datasheet. Often times a range will be provided where the peptide falls within, or if it was raised against a larger recombinant protein as is the case for the one you inquired about we do not know exactly where the binding occurs.

Additional UNC13D/Munc 13-4 Products

Blogs on UNC13D/Munc 13-4

There are no specific blogs for UNC13D/Munc 13-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UNC13D/Munc 13-4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol UNC13D