Recombinant Human ULK1 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human ULK1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 602-715 of Human ULK1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: LRGSPKLPDFLQRNPLPPILGSPTKAVPSFDFPKTPSSQNLLALLARQGVVMTPPRNRTLPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTDLLLKAAFGTQAPDPG

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: ULK1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 38.28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ULK1 GST (N-Term) Protein

• ATG1 autophagy related 1 homolog
• ATG1
• ATG1A
• EC 2.7.11
• EC 2.7.11.1
• FLJ38455
• FLJ46475
• hATG1
• KIAA0722
• serine/threonine-protein kinase ULK1
• ULK1
• unc-51 (C. elegans)-like kinase 1
• UNC51
• Unc51.1
• unc-51-like kinase 1 (C. elegans)
• Unc-51-like kinase 1

Background

ULK1 belongs to the serine/threonine protein kinase family. It is involved in axon growth and plays an essential role in neurite branching during sensory axon outgrowth. Knockdown of ULK1 results in impaired endocytosis of nerve growth factor (NGF), excessive axon arborization, and severely stunted axon elongation indicating that ULK1 mediates a non clathrin coated endocytosis in sensory growth cones. Knockdown of ULK1 also inhibits the autophagic response. It appears to act as a convergence point for multiple signals that regulate autophagy, and in turn interacts with a large number of autophagy related (Atg) proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ULK1