UGT1A6 Antibody - BSA Free

Immunohistochemistry-Paraffin: UGT1A6 Antibody [NBP2-49113] - Staining of human urinary bladder shows high expression.

Immunohistochemistry: UGT1A6 Antibody [NBP2-49113] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: UGT1A6 Antibody [NBP2-49113] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: UGT1A6 Antibody [NBP2-49113] - Staining in human urinary bladder and endometrium tissues using anti-UGT1A6 antibody. Corresponding UGT1A6 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UGT1A6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UGT1A6 Antibody - BSA Free (NBP2-49113) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WLSMKDIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UGT1A6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  UGT1A6 Recombinant Protein Antigen (NBP2-49113PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UGT1A6 Antibody - BSA Free

• GNT1UDPGT 1-6
• HLUGP
• HLUGP1
• MGC29860
• Phenol-metabolizing UDP-glucuronosyltransferase
• UDP glucuronosyltransferase 1 family, polypeptide A6
• UDP glycosyltransferase 1 family, polypeptide A6
• UDP-glucuronosyltransferase 1 family polypeptide A6s
• UDP-glucuronosyltransferase 1-6
• UDP-glucuronosyltransferase 1A6
• UDP-glucuronosyltransferase 1-F
• UDPGT
• UGT1
• UGT1*6
• UGT1.6
• UGT1-06
• UGT1A6S
• UGT-1F
• UGT1FEC 2.4.1.17

Background

UGT1A6 encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UGT1A6