UFD1L Antibody - BSA Free

Immunohistochemistry-Paraffin: UFD1L Antibody [NBP1-86879] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Analysis in control (vector only transfected HEK293T lysate) and UFD1L over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UFD1L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UFD1L Antibody - BSA Free (NBP1-86879) is a polyclonal antibody validated for use in IHC and WB. Anti-UFD1L Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLG
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UFD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  UFD1L Protein (NBP1-86879PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for UFD1L Antibody - BSA Free

• ATP1C
• ATP1G1ATPase, Na+/K+ transporting, gamma 1 polypeptide
• FXYD domain containing ion transport regulator 2
• FXYD domain-containing ion transport regulator 2
• HOMG2
• hypomagnesemia 2, renal
• MGC12372
• Na(+)/K(+) ATPase subunit gamma
• Sodium pump gamma chain
• sodium/potassium-transporting ATPase subunit gamma
• Sodium-potassium-ATPase, gamma polypeptide

Background

The protein encoded by the UFD1L gene forms a complex with two other proteins, nuclear protein localization-4 and valosin-containing protein, and this complex is necessary for the degradation of ubiquitinated proteins. In addition, this complex controls the disassembly of the mitotic spindle and the formation of a closed nuclear envelope after mitosis. Mutations in this gene have been associated with Catch 22 syndrome as well as cardiac and craniofacial defects. Alternative splicing results in multiple transcript variants encoding different isoforms. A related pseudogene has been identified on chromosome 18. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UFD1L Antibody (NBP1-86879)(1)

Publication using NBP1-86879

• Wang K Z Q, Steer E et al. PINK1 Interacts with VCP/p97 and Activates PKA to Promote NSFL1C/p47 Phosphorylation and Dendritic Arborization in Neurons. Eneuro 2019-02-21 [PMID: 30783609]

Bioinformatics

• Gene Symbol: UFD1