UFD1L Antibody

Images

 
Western Blot: UFD1L Antibody [NBP1-86879] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: UFD1L Antibody [NBP1-86879] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: UFD1L Antibody [NBP1-86879] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UFD1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UFD1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UFD1L Protein (NBP1-86879PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UFD1L Antibody

  • ATP1C
  • ATP1G1ATPase, Na+/K+ transporting, gamma 1 polypeptide
  • FXYD domain containing ion transport regulator 2
  • FXYD domain-containing ion transport regulator 2
  • HOMG2
  • hypomagnesemia 2, renal
  • MGC12372
  • Na(+)/K(+) ATPase subunit gamma
  • Sodium pump gamma chain
  • sodium/potassium-transporting ATPase subunit gamma
  • Sodium-potassium-ATPase, gamma polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-82166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5758
Species: Hu
Applications: WB, IHC, ICC
MAB1904
Species: Hu
Applications: WB, IHC, ICC
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-46076
Species: Hu
Applications: WB, IHC
NBP1-85723
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15374
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
MAB25031
Species: Hu
Applications: WB, IHC, IP
AF3876
Species: Hu, Mu
Applications: WB, IHC
NB100-2526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, KO

Publications for UFD1L Antibody (NBP1-86879) (0)

There are no publications for UFD1L Antibody (NBP1-86879).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UFD1L Antibody (NBP1-86879) (0)

There are no reviews for UFD1L Antibody (NBP1-86879). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UFD1L Antibody (NBP1-86879) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UFD1L Products

Bioinformatics Tool for UFD1L Antibody (NBP1-86879)

Discover related pathways, diseases and genes to UFD1L Antibody (NBP1-86879). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UFD1L Antibody (NBP1-86879)

Discover more about diseases related to UFD1L Antibody (NBP1-86879).
 

Pathways for UFD1L Antibody (NBP1-86879)

View related products by pathway.

PTMs for UFD1L Antibody (NBP1-86879)

Learn more about PTMs related to UFD1L Antibody (NBP1-86879).

Blogs on UFD1L

There are no specific blogs for UFD1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UFD1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UFD1L