Recombinant Human UCP3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UCP3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-209 of Human UCP3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRALMKVQMLRESPF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
UCP3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UCP3 Protein

  • mitochondrial uncoupling protein 3
  • SLC25A9Solute carrier family 25 member 9
  • UCP 3
  • uncoupling protein 3 (mitochondrial, proton carrier)
  • Uncoupling protein-3

Background

UCP3( AAH08392, 1 a.a. - 210 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56930
Species: Hu
Applications: ICC/IF
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57763
Species: Hu
Applications: ICC/IF
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2564
Species: Hu
Applications: WB
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP

Publications for UCP3 Recombinant Protein (H00007352-P01) (0)

There are no publications for UCP3 Recombinant Protein (H00007352-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCP3 Recombinant Protein (H00007352-P01) (0)

There are no reviews for UCP3 Recombinant Protein (H00007352-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UCP3 Recombinant Protein (H00007352-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UCP3 Products

Bioinformatics Tool for UCP3 Recombinant Protein (H00007352-P01)

Discover related pathways, diseases and genes to UCP3 Recombinant Protein (H00007352-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UCP3 Recombinant Protein (H00007352-P01)

Discover more about diseases related to UCP3 Recombinant Protein (H00007352-P01).
 

Pathways for UCP3 Recombinant Protein (H00007352-P01)

View related products by pathway.

PTMs for UCP3 Recombinant Protein (H00007352-P01)

Learn more about PTMs related to UCP3 Recombinant Protein (H00007352-P01).

Blogs on UCP3

There are no specific blogs for UCP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

UCP3 Antibody
NBP2-24608

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UCP3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UCP3