UCP1 Antibody (4E5)

Images

 
Sandwich ELISA: UCP1 Antibody (4E5) [H00007350-M01] - Detection limit for recombinant GST tagged UCP1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related UCP1 Primary Antibodies

Order Details


    • Catalog Number
      H00007350-M01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

UCP1 Antibody (4E5) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
UCP1 (NP_068605, 232 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF
Specificity
UCP1 (4E5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UCP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UCP1 Antibody (4E5)

  • SLC25A7
  • SLC25A7mitochondrial brown fat uncoupling protein 1
  • Solute carrier family 25 member 7
  • Thermogenin
  • UCP 1
  • UCP
  • UCP1
  • uncoupling protein 1 (mitochondrial, proton carrier)

Background

Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-59742
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, WB
NBP2-24608
Species: Hu, Mu, Pm, Rt
Applications: WB
NBP2-92503
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
DLP00
Species: Hu
Applications: ELISA
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-59598
Species: Hu, Mu
Applications: IHC, WB
NBP2-94703
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-04676
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
DRP300
Species: Hu
Applications: ELISA
NBP2-94007
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for UCP1 Antibody (H00007350-M01) (0)

There are no publications for UCP1 Antibody (H00007350-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCP1 Antibody (H00007350-M01) (0)

There are no reviews for UCP1 Antibody (H00007350-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UCP1 Antibody (H00007350-M01). (Showing 1 - 1 of 1 FAQ).

  1. How specific are the UCP1 antibodies to UCP1 than to UCP2 and 3?
    • None of our UCP1 antibodies have been tested for cross-reactivity with UCP2 or UCP3, so we cannot guarantee that these antibodies will not bind to the other UCP proteins. However, we can determine the likelihood of this cross-reactivity by running sequence alignments using the immunogen sequences. NB100-2828 is the most likely to be specific for UCP1: its short immunogen sequence is shown on its datasheet, and when I run a UniProt BLAST sequence comparison for human proteins it detects a match with UCP1 (100%), but not UCP2 or UCP3. When I use MultAlin to align the immunogen sequence with the UCP2 and UCP3 protein sequences, it shows only low similarity. For the antibodies with product codes beginning H00007350, again the immunogen sequence is shown on the datasheets for the products. In this case, the immunogen sequence (shared between them) is a little longer. When I run the UniProt Blast, the results are 100% UCP1, 66% UCP3 and 58% UCP2. For NBP2-20796, the exact immunogen sequence is not available, but I have run the UniProt Blast on the amino acid range given, and the results are 100% UCP1, 59% UCP2 and 58% UCP3. Percentages in the 50s-60s suggest that the antibody probably won't cross-react, but may.

Secondary Antibodies

 

Isotype Controls

Additional UCP1 Products

Research Areas for UCP1 Antibody (H00007350-M01)

Find related products by research area.

Blogs on UCP1

There are no specific blogs for UCP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UCP1 Antibody (4E5) and receive a gift card or discount.

Bioinformatics

Gene Symbol UCP1
Entrez
OMIM
Uniprot