UCP1 Antibody (4B7) Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
UCP1 (NP_068605, 232 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF |
| Specificity |
UCP1 - uncoupling protein 1 (mitochondrial, proton carrier) (4B7) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
UCP1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot
|
| Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
Reactivity Notes
Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for UCP1 Antibody (4B7)
Background
Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, WB
Species: Hu, Mu, Pm, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, WB
Publications for UCP1 Antibody (H00007350-M03) (0)
There are no publications for UCP1 Antibody (H00007350-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for UCP1 Antibody (H00007350-M03) (0)
There are no reviews for UCP1 Antibody (H00007350-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for UCP1 Antibody (H00007350-M03). (Showing 1 - 1 of 1 FAQ).
-
How specific are the UCP1 antibodies to UCP1 than to UCP2 and 3?
- None of our UCP1 antibodies have been tested for cross-reactivity with UCP2 or UCP3, so we cannot guarantee that these antibodies will not bind to the other UCP proteins. However, we can determine the likelihood of this cross-reactivity by running sequence alignments using the immunogen sequences. NB100-2828 is the most likely to be specific for UCP1: its short immunogen sequence is shown on its datasheet, and when I run a UniProt BLAST sequence comparison for human proteins it detects a match with UCP1 (100%), but not UCP2 or UCP3. When I use MultAlin to align the immunogen sequence with the UCP2 and UCP3 protein sequences, it shows only low similarity. For the antibodies with product codes beginning H00007350, again the immunogen sequence is shown on the datasheets for the products. In this case, the immunogen sequence (shared between them) is a little longer. When I run the UniProt Blast, the results are 100% UCP1, 66% UCP3 and 58% UCP2. For NBP2-20796, the exact immunogen sequence is not available, but I have run the UniProt Blast on the amino acid range given, and the results are 100% UCP1, 59% UCP2 and 58% UCP3. Percentages in the 50s-60s suggest that the antibody probably won't cross-react, but may.
Secondary Antibodies
| |
Isotype Controls
|
Additional UCP1 Products
Research Areas for UCP1 Antibody (H00007350-M03)
Find related products by research area.
|
Blogs on UCP1