UCP1 Antibody (4B7)

Images

 
Western Blot: UCP1 Antibody (4B7) [H00007350-M03] - Analysis of UCP1 expression in NIH/3T3 (Cat # L018V1).
Sandwich ELISA: UCP1 Antibody (4B7) [H00007350-M03] - Detection limit for recombinant GST tagged UCP1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
4B7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UCP1 Antibody (4B7) Summary

Immunogen
UCP1 (NP_068605 232 a.a. - 267 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF
Specificity
UCP1 - uncoupling protein 1 (mitochondrial, proton carrier) (4B7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UCP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UCP1 Antibody (4B7)

  • SLC25A7
  • SLC25A7mitochondrial brown fat uncoupling protein 1
  • Solute carrier family 25 member 7
  • Thermogenin
  • UCP 1
  • UCP
  • UCP1
  • uncoupling protein 1 (mitochondrial, proton carrier)

Background

Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-24608
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-56930
Species: Hu
Applications: ICC/IF
NBP2-57763
Species: Hu
Applications: ICC/IF
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80528
Species: Hu
Applications: WB
NBP1-88813
Species: Hu
Applications: WB, IHC, IHC-P
H00007350-M03
Species: Hu, Mu
Applications: WB, ELISA

Publications for UCP1 Antibody (H00007350-M03) (0)

There are no publications for UCP1 Antibody (H00007350-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCP1 Antibody (H00007350-M03) (0)

There are no reviews for UCP1 Antibody (H00007350-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UCP1 Antibody (H00007350-M03). (Showing 1 - 1 of 1 FAQ).

  1. How specific are the UCP1 antibodies to UCP1 than to UCP2 and 3?
    • None of our UCP1 antibodies have been tested for cross-reactivity with UCP2 or UCP3, so we cannot guarantee that these antibodies will not bind to the other UCP proteins. However, we can determine the likelihood of this cross-reactivity by running sequence alignments using the immunogen sequences. NB100-2828 is the most likely to be specific for UCP1: its short immunogen sequence is shown on its datasheet, and when I run a UniProt BLAST sequence comparison for human proteins it detects a match with UCP1 (100%), but not UCP2 or UCP3. When I use MultAlin to align the immunogen sequence with the UCP2 and UCP3 protein sequences, it shows only low similarity. For the antibodies with product codes beginning H00007350, again the immunogen sequence is shown on the datasheets for the products. In this case, the immunogen sequence (shared between them) is a little longer. When I run the UniProt Blast, the results are 100% UCP1, 66% UCP3 and 58% UCP2. For NBP2-20796, the exact immunogen sequence is not available, but I have run the UniProt Blast on the amino acid range given, and the results are 100% UCP1, 59% UCP2 and 58% UCP3. Percentages in the 50s-60s suggest that the antibody probably won't cross-react, but may.

Secondary Antibodies

 

Isotype Controls

Additional UCP1 Products

Bioinformatics Tool for UCP1 Antibody (H00007350-M03)

Discover related pathways, diseases and genes to UCP1 Antibody (H00007350-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UCP1 Antibody (H00007350-M03)

Discover more about diseases related to UCP1 Antibody (H00007350-M03).
 

Pathways for UCP1 Antibody (H00007350-M03)

View related products by pathway.

PTMs for UCP1 Antibody (H00007350-M03)

Learn more about PTMs related to UCP1 Antibody (H00007350-M03).

Blogs on UCP1

There are no specific blogs for UCP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UCP1 Antibody (4B7) and receive a gift card or discount.

Bioinformatics

Gene Symbol UCP1
Entrez
Uniprot