UBXN10 Antibody


Western Blot: UBXN10 Antibody [NBP1-83562] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: UBXN10 Antibody [NBP1-83562] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

UBXN10 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:QLSSIRALYQDETGTMKTSEEDSRARACAVERKFIVRTKKQGSSRAGNLEEPSDQEPRLLLAVRSPTGQ
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
UBXN10 Protein (NBP1-83562PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for UBXN10 Antibody

  • FLJ25429
  • UBX domain containing 3
  • UBX domain protein 10
  • UBX domain-containing protein 10
  • UBX domain-containing protein 3
  • UBXD3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, ICC
Species: Hu, Mu
Applications: WB
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for UBXN10 Antibody (NBP1-83562) (0)

There are no publications for UBXN10 Antibody (NBP1-83562).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBXN10 Antibody (NBP1-83562) (0)

There are no reviews for UBXN10 Antibody (NBP1-83562). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBXN10 Antibody (NBP1-83562) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional UBXN10 Antibody Products

Related Products by Gene

Bioinformatics Tool for UBXN10 Antibody (NBP1-83562)

Discover related pathways, diseases and genes to UBXN10 Antibody (NBP1-83562). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UBXN10

There are no specific blogs for UBXN10, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our UBXN10 Antibody and receive a gift card or discount.


Gene Symbol UBXN10

Customers Who Bought This Also Bought