UBXN10 Antibody

Images

 
Western Blot: UBXN10 Antibody [NBP1-83562] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: UBXN10 Antibody [NBP1-83562] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

UBXN10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QLSSIRALYQDETGTMKTSEEDSRARACAVERKFIVRTKKQGSSRAGNLEEPSDQEPRLLLAVRSPTGQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBXN10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
UBXN10 Protein (NBP1-83562PEP)

Alternate Names for UBXN10 Antibody

  • FLJ25429
  • UBX domain containing 3
  • UBX domain protein 10
  • UBX domain-containing protein 10
  • UBX domain-containing protein 3
  • UBXD3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-27154
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, Flow, IHC-P
NBP1-88954
Species: Hu
Applications: IHC, IHC-P
AF4509
Species: Hu
Applications: WB, ICC
NBP2-27073
Species: Hu, Mu, Bv, Eq, Op, Pm
Applications: WB, IHC-P
NBP1-32682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13561
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14408
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19727
Species: Hu
Applications: WB, IHC, IHC-P
AF2864
Species: Hu
Applications: WB, ICC
MAB6435
Species: Hu, Mu
Applications: WB
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00004938-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP
H00284111-M06
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00129790-R01
Species: Hu
NBP2-03828
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
NBP1-90495
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81123
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for UBXN10 Antibody (NBP1-83562) (0)

There are no publications for UBXN10 Antibody (NBP1-83562).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBXN10 Antibody (NBP1-83562) (0)

There are no reviews for UBXN10 Antibody (NBP1-83562). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBXN10 Antibody (NBP1-83562) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBXN10 Antibody Products

Related Products by Gene

Bioinformatics Tool for UBXN10 Antibody (NBP1-83562)

Discover related pathways, diseases and genes to UBXN10 Antibody (NBP1-83562). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UBXN10

There are no specific blogs for UBXN10, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol UBXN10

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-83562 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought